1TU1,6E8A


Conserved Protein Domain Family
DcrB

?
pfam08786: DcrB 
Click on image for an interactive view with Cn3D
DcrB
DcrB is a bacterial protein required for phages C1 and C6 adsorption. It may be involved in the opening or formation of diffusion channels in the outer membrane. Structurally, it consist of an antiparallel beta sheet with some alpha helical regions.
Statistics
?
PSSM-Id: 400922
View PSSM: pfam08786
Aligned: 41 rows
Threshold Bit Score: 98.4564
Threshold Setting Gi: 506349791
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TU1_A        10 EADLEIPDAWQDQS---------INIFKLPASGparEASFVISRDASQGDAPFADYVARQLENAEKQLPGFKLhkrwDIN 80  Pseudomonas aer...
WP_020951641   6 EGTLDLPDSWKDQT---------INVISSTAAMe-pGLTVSITRDTLPWGMGFSEYVEDQIKQIEDALDEFKLmgrkPAT 75  Paracoccus amin...
WP_002213861   6 EGSLELPEAWRDMT---------VNVLTSSLDEt-vGLSFTVSRDTPPWGMGFHEFFDREIGSLSRQLNHYQLlhqdTGE 75  Yersinia pseudo...
CBJ79431      14 aGTIKLPASWQDSS---------ILVLNSPDDKn--GTSFTISRDSLPWGLAFNQFAEREMTAIGKQLKDYEVlaheAGE 82  Xenorhabdus bov...
WP_015869510  54 kigFTLPAGLSDQTsklgsqtnnMSVYANKT-----GQQAVIVILAPMPQDNLNALSTRLIDQQKSRDASLQLlsseSVK 128 Edwardsiella ic...
WP_002440595  49 klAFSLPAGMSDQSgklgtqtnnMHVYSDTT-----GQKAVIVIVGDTSDEPLNVLADRLQAQQRNRDPQLQVvankAIQ 123 Shimwellia blattae
WP_013204263  49 klgFTLPAGMSDQSgklgtqannMHVYADAT-----GQKAIIVIEGDATTDGLDVLAGRLEQQQRNRDPQLQVvtnkAIE 123 Erwinia
BAN99087      49 klCFSLPAGMSDKSgklgsestnMHVYADET-----GQRAIIVIAGDPTSEGLDALTQRLEQQQRNRDPQLQVvsnkAVT 123 Plautia stali s...
Q2NWX3        50 klaFTLPGDMSDQSgkvgtqannMHVYADST-----GRKAVIIILSDDTPQGLDTLAQRLENEQRARDPDLQVvtnkAIT 124 Sodalis glossin...
6E8A_A        20 kLSFSLPADMTDQSgklgtqannMHVYSDPT-----GQKAVIVIVGDNTDEALPVLANRLLEQQRSRDPQLQVvtnkSIE 94  Salmonella ente...
1TU1_A        81 IHGHAAVLLDYQWQREGRDLMLRQVFIERR-PAVLITTLTTTPADLPHHEPAWKQAMQT 138 Pseudomonas aeruginosa PAO1
WP_020951641  76 LSRAAAYEIECSWKAKQGPIHQIITTIQLAdNRAMVITASVPGAMTPSQQTEVRRIVST 134 Paracoccus aminophilus
WP_002213861  76 VNNHPSVTAEFCWSSEQGRIHQLMTLVDIA-PRVLILTATMVGELTPQQKEHITAIVQT 133 Yersinia pseudotuberculosis complex
CBJ79431      83 LNGHETETFEFRWRAPSGPVHQLMMMLNAP-GQVLIFTGTCQGEMTPAQKAQMQAMMAT 140 Xenorhabdus bovienii SS-2004
WP_015869510 129 LGGKEVEKVVSMQQANGHAIYSSIILAQVG-DQLMTMQISLPGDNRQEAANIANGVLDT 186 Edwardsiella ictaluri
WP_002440595 124 VNGHDLQQLDSIISAKGQTAWSSVIIGKVD-GKLLTMQITLPADDQQKAQSEAENIIST 181 Shimwellia blattae
WP_013204263 124 ISGQPAQQLDTVISAKNQSSWSSVVLAKVD-GKLLTMQITLPAENQQQSQTDSENIIKT 181 Erwinia
BAN99087     124 LKDQPAQQLDTVISANNQTSWSSVILAKVD-GKLLMLQITLPADNQQQAQSDADAIVKS 181 Plautia stali symbiont
Q2NWX3       125 VNGKPLQQLDSIVASGGKQAYSAVVLGKVD-NHLLTMQVTLPADDQQKAQSAAESIIKT 182 Sodalis glossinidius str. 'morsitans'
6E8A_A        95 LKGHTLQQLDSIISAKGQTAYSSIVLGKVD-NQLLTIQVTLPADNQQKAQTTAENIINT 152 Salmonella enterica subsp. enterica ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap