6I1D


Conserved Protein Domain Family
DWNN

?
pfam08783: DWNN 
Click on image for an interactive view with Cn3D
DWNN domain
DWNN is a ubiquitin like domain found at the N-terminus of the RBBP6 family of splicing-associated proteins. The DWNN domain is independently expressed in higher vertebrates so it may function as a novel ubiquitin-like modifier of other proteins.
Statistics
?
PSSM-Id: 400919
View PSSM: pfam08783
Aligned: 110 rows
Threshold Bit Score: 58.243
Threshold Setting Gi: 154799536
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6I1D_B                5 IFYRFKSQRNTSRILFDGTGLTVFDLKREIIQENKLg--DGTDFQLKIYNPDTEEEYDDDAFVIPRSTSVIVKRS 77  Saccharomyces...
ELQ75594              5 IHYRFVSSTNAQKLTFEGASIPLWELRTEIINMERM---TAKDFDLLFF--IDDNQLTNESTPVYRNTTVIVKRI 74  Trachipleisto...
EIJ88920              3 VLYRFRSERDFSKIETDRSSMPLWELKAEIAAKRYL---TFHDYHLIFYVENEKAPITDNYAVIYSNMSIVIERV 74  Nematocida pa...
WGS:AFBI:EDEG_03461   5 IYYRFNSSKNFSKLVISAESLPLWELRAEIVTVNKM---VSNDFDLLFY--EEGNLIDDEYFIIHKNARITLKRV 74  Edhazardia ae...
EOB13064              5 INYKFRSMKNYASINIEGGGIPLWELKYEIITQRKM---QSKDFDLVFFDNQTNEKILDEYQIIERNSHIIVERI 76  Nosema bombyc...
Q8STW4                5 INYRFRSNKNFSRISFQGTGLPLWELKYEIINQRKM---VSKDFDLLFFDGETNEEINDEYQVVSMNSHVIVSRI 76  Encephalitozo...
XP_007604488          5 IYYKFKSYKDFSTVVFEGTGLPLWELKYEIVSQRKM---NAKDFDLLFFDEETNEQLVDEYAQISRNSYIIVQRI 76  Vittaforma co...
EED44613              5 INYRFKSYKNFSKIFFEGESLSLWEIKYEIINQRKM---NSKDFDLLFYDADSGERIEDEYLKIEKNSRLVIERI 76  Enterocytozoo...
XP_005850514          5 VRYRFKNAVAEDVVTFDGAVIQIGEVKRLIALKRGLgadGA--AELTLFDATSGEEQADESKVIPRNTLVLVKRS 77  Chlorella var...
EGD76092              5 IHYKFKNELQSSTVTFDGARMLYETLKRDVFLRHYG---RSTDTDIDLIDEHSGQ-VYGPGDHIYKNAHIVISak 75  Salpingoeca r...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap