Conserved Protein Domain Family
SARS_X4

?
pfam08779: SARS_X4 
SARS coronavirus X4 like
The structure of the coronavirus X4 protein (also known as 7a and U122) shows similarities to the immunoglobulin like fold and suggests a binding activity to integrin I domains. In SARS-CoV- infected cells, the X4 protein is expressed and retained intra-cellularly within the Golgi network. X4 has been implicated to function during the replication cycle of SARS-CoV.
Statistics
?
PSSM-Id: 400915
View PSSM: pfam08779
Aligned: 3 rows
Threshold Bit Score: 202.211
Threshold Setting Gi: 30173396
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AIA62283  16 ELYHYQECVRGTTVLLEEPCPSGTYEGNSPFHPLADNKFALTCISTHFAFACADGTRHTYQLRARSVSPKLFTRQEKVYQ 95  BtRf-BetaCoV/JL2012
P59635    16 ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQ 95  Severe acute respir...
ADE34784  16 ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCSSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVYQ 95  Bat SARS coronaviru...
AIA62283  96 ELYSPLFLIVAALVFIILCFTIKRKIE 122 BtRf-BetaCoV/JL2012
P59635    96 ELYSPLFLIVAALVFLILCFTIKRKTE 122 Severe acute respiratory syndrome-related coronavirus
ADE34784  96 ELYSPLFLIVAALVFIILCFTIKRKTE 122 Bat SARS coronavirus HKU3-9
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap