Conserved Protein Domain Family
ParB

?
pfam08775: ParB 
ParB family
ParB is a component of the par system which mediates accurate DNA partition during cell division. It recognizes A-box and B-box DNA motifs. ParB forms an asymmetric dimer with 2 extended helix-turn-helix (HTH) motifs that bind to A-boxes. The HTH motifs emanate from a beta sheet coiled coil DNA binding module. Both DNA binding elements are free to rotate around a flexible linker, this enables them to bind to complex arrays of A- and B-box elements on adjacent DNA arms of the looped partition site.
Statistics
?
PSSM-Id: 400911
View PSSM: pfam08775
Aligned: 9 rows
Threshold Bit Score: 137.538
Threshold Setting Gi: 123560689
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAX53592              193 FPSISDLAIPDYQLLLEIAEQTKARQVDVLEVVEGVRIRIEK-DRAYDAQDPLNKTKIIGFFKAESNGLKAPRKMKKA-V 270 Erwini...
wugsc:KPN_pKPN5p08224 194 FPVQSELSFSDYKLLLEVNEKLSEKGLTPEELIQAVSAQLDAiLNDGERPEDEQKASILKLISQASQALIDPSPKEKS-V 272 Klebsi...
ADD79355              193 FPNQSELTYPDYKALLQAADKLSETGQTVEALINAISAEIDVvRARDGLAEDELKNTILRLIRQGSQTLVKEPEKDKT-T 271 Pantoe...
Q327G3                195 FPVQSELTYADYRQLAELSERLRLGDISIDEVVKNISPSIELiTADDNLSEDEVKNSIMRLITKEMSSLLDSGVKDKA-V 273 Shigel...
Q6LWB2                226 FPNANNLTRKDYELLEKVTHQFAGMPSAMSDFIIDVTNEHNQ--SNFELSVDEQHDELIKLITSKLADQKKAVKKDTGrK 303 Photob...
Q8E843                233 FPVASDLSHTDYALLNKVMEVYEFED-ELIEFINDLTQKIVIiQVEYSRA--ERKSAIIKAMKSELQIAKDMKSKALV-S 308 Shewan...
Q326T4                182 FPIASELNFNDYKILFNYYKGLEKANESLSSTLPILKEEIKDl--DTNLPPDIYKKEILNIIKKSKNRKQNPSLK----- 254 Shigel...
wugsc:KPN_pKPN4p07090 196 FPVINELSLADYQLLLKISEDLDSKGVPLSDLLGKVQADISA-----AKVESVSKSLIMDSFKRHSKQLKPAPVKTVQ-- 268 Klebsi...
O68788                194 FPVINDISLSDYQFLLKLAEEANNKQTSVTELMEKVQHRLKT----MPDYPAIDKSKILAVIRSESKLLTALPTRTVQ-- 267 Yersin...
CAX53592              271 VEKLAEFSDKKQFARKKTdaEKRLVTYEFSRIPAKYHAELDAAIKIVMD 319 Erwinia billingiae Eb661
wugsc:KPN_pKPN5p08224 273 VSPLWSFEEKDKFARKRV--KGRTLTYEFSRMSKVIQDELDKAINEVLD 319 Klebsiella pneumoniae subsp. pneumoni...
ADD79355              272 AVALWSFADKDRFARKKT--RGRMFSYEFNRQSKELQDELDKVIAETLK 318 Pantoea ananatis LMG 20103
Q327G3                274 VTLLWKFDSKDKFARKRV--KGRTFSYEFGRLPLEVQDKLDRMIALVLK 320 Shigella dysenteriae Sd197
Q6LWB2                304 VLPIAEFTESGVFARKVK--KNRFFGYEFGRIPNDVQDKLDSAIQAIIC 350 Photobacterium profundum
Q8E843                309 VTNLATFDSSGIYARKRI--KGRNFAYEFGRLSLDIQKQLDIAIVDVLK 355 Shewanella oneidensis
Q326T4                255 VDSLFISKDKRTYIKRKEnkTNRTLIFTLSKINKTVQREIDEAIRDIIS 303 Shigella dysenteriae Sd197
wugsc:KPN_pKPN4p07090 269 TEKLREFEDKKQFARKKTdpSKRLVTYEFARLPASVQAELDKAIRLVMG 317 Klebsiella pneumoniae subsp. pneumoni...
O68788                268 TEKLREFSDRNQFARKKTdpKKRLVVYEFSRISAEAQSEIDKAIKRILE 316 Yersinia pestis KIM10+
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap