5FVM,1AUE


Conserved Protein Domain Family
FRB_dom

?
pfam08771: FRB_dom 
FKBP12-rapamycin binding domain
The macrolide antibiotic rapamycin and the cytosol protein FKBP12 can form a complex which specifically inhibits the TORC1 complex, leading to growth arrest. The FKBP12-rapamycin complex interferes with TORC1 function by binding to the FKBP12-rapamycin binding domain (FRB) of the TOR proteins. This entry represents the FRB domain.
Statistics
?
PSSM-Id: 400907
View PSSM: pfam08771
Aligned: 84 rows
Threshold Bit Score: 87.639
Threshold Setting Gi: 74682425
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5FVM_A       1953 ELIRVAVL-WHELWYEGLEDASRQFFGEHNT-EKMFATLEPLHEMLKRGPE--TLREISFQNSFGRDLNDAYEWVLNYKR 2028
XP_001311334 1609 ELMRVACT-RFELCYNCI----RDTLFEPN--EFTTKYLHQLFEQNSK--EneTFLDVSFSREFGNLLNLLEEWVKKYEE 1679 Trichomonas v...
XP_001706690 2717 ELQRVAIL-WPEIAYDLITQASTAFCEEPRDlVKFFNYACQLQLLASRTPE--TQSESVFIQMFSSQLQAAWDSCRQFPV 2793 Giardia lambl...
EAY20546     1712 EMMRVSVS-WFELAYQCIDESSHEFCPDVNK-QMMLKFLDPLKEILSK--KceTCMESKFFAQNYSHLKIAFGLLKKYEE 1787 Trichomonas v...
EAY17625     1693 EMIRVAVT-WWEQWFGILDEASRAYLLRNDI-NEMCELLEPLNEVISKEPS--TYFEVSFLAQFGLSLANAHSCIKEYRR 1768 Trichomonas v...
EAY10428     1712 EIIRIAVS-WWELWFGVLDDASRAYLIKQDV-NEMLSLLLPAHEITEKEPK--TYYEIAFVAQFGESLQRAKKMLMDYKK 1787 Trichomonas v...
XP_001318165 1681 ELIRIGTS-WFEIWTQALEETSKMYDH-----VKAANILLPLHAVIEKPPE--TMFEVSFAAQFGSVLLQAHSLLDAFLN 1752 Trichomonas v...
Q5K8Y1        341 ELIRTSISkWRGIIDGFL---PRQDLMEIKW-QDIPEIWEEDLRMLTN-PE--TPDEHQFVLQYGEQLHLVDKTLIRYNS 413  Cryptococcus ...
Q38AC2       1891 ELVRCAVL-WPELWINELGRALYQWERQRSA-ENLLLAMGPLLEQLKR-PE--TMAEAQFAAELRQPLENACCHVERAVS 1965 Trypanosoma b...
CAM73126     1993 ELVRCAVL-WTELWFDELERAWFQWGRDKNA-HNVFLVLQPLLEQLSH-PN--TLAESHFVAEFGELLGGACEYVEKAAS 2067 Leishmania in...
5FVM_A       2029 TKDINNLNQAWDIYYNVFRRIS 2050
XP_001311334 1680 TKDHTHKNMIYNVMGQIWLKIK 1701 Trichomonas vaginalis G3
XP_001706690 2794 TNDLVCLNIVMKHYKEIYDRIH 2815 Giardia lamblia ATCC 50803
EAY20546     1788 NDDLGSLNEVWDHFSTVFNKLR 1809 Trichomonas vaginalis G3
EAY17625     1769 TQNEQCVLSAWQTYYSVYQDLK 1790 Trichomonas vaginalis G3
EAY10428     1788 TNDDIHLIQAWGIYISIFNQLK 1809 Trichomonas vaginalis G3
XP_001318165 1753 DHDEDAYNRAWSIYVPVLKKVR 1774 Trichomonas vaginalis G3
Q5K8Y1        414 SRQLNLVNNAYSTLYRLYGEIE 435  Cryptococcus neoformans
Q38AC2       1966 SRHEQFMEEARRIFVSIERRIR 1987 Trypanosoma brucei
CAM73126     2068 TGNNVYMEDAWNRFKTAVKRMD 2089 Leishmania infantum JPCM5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap