Conserved Protein Domain Family
PIN_5

?
pfam08745: PIN_5 
PINc domain ribonuclease
This is a family of bacterial and archaeal PINc domains. PIN domains are characterized by the conservation of three acidic residues, possibly four, an Asp at residue 13, a Glu at 63, and then Asps at 172 and 194 in UniProtKB:Q58360.
Statistics
?
PSSM-Id: 400888
View PSSM: pfam08745
Aligned: 37 rows
Threshold Bit Score: 210.912
Threshold Setting Gi: 335360229
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A6UVK7           5 RFCIDTTAITDTEVRSSLGVDGISESTKIMLDLIAD--SRVNLGISCHIPyPSVYDELIGFLKRENCPKETIIKVDTWLV 82  Methanococcus...
A8A8M4           3 KFVIDTSAVTDPRLRQLFGVNELWEVVEKYLELMAL--AKLKLGFSFYTT-PSVMKEIKGFLERSMCPSEIISKLGVWIL 79  Ignicoccus ho...
Q9YBN4          12 vVVADTTMFTDAKLREVLGARSLEEAARIMARILAR--AS-RMGLTVYIT-PSVRAEIERFMLGNGVHPTTIARLMAWVR 87  Aeropyrum per...
A3DL59           4 iYVLDTSAVTDPRLREIFGVKTLDGVVREYARLLIR--SHIVLGAEFYTT-PSTALELRSFLERNNVSREAIDMLMGAIT 80  Staphylotherm...
jgi:Pyrfu_0011  13 VFVLDTSALTDPRLREVFRVQTLDEVVKHIVGLLRE--ARTKLGIEFYTT-PTMFSEMKRFLLSNGVQPETIEMLQAWML 89  Pyrolobus fum...
B3DWH2           3 KFVLDTSIFTNPDVSQQFGDDDS-SVFSGFLSLASK--AEALF----YMP-LSAYKELKLIKGTAFFSSD----FEFIVH 70  Methylacidiph...
Q0A5J1           3 RFVLDTSVFTNPHCAVQFGEDPL-AGVQTFLHLARR--CPAEF----YMP-LSVYDEFRRMRDLAEMAAD----FETDVW 70  Alkalilimnico...
A1WZ95           3 RFVLDTSVFTNPDVYLRFDEEPM-QAISVFLGLARR--ADAEF----YMP-GPVYQELCNLRSMDLIGAE----FETEVY 70  Halorhodospir...
jgi:Thein_2060  11 RLIPDTSVFTNPDVYREFGNSPN-EAFANFLELVAK--A---PNVKVYMP-SSVYDELKKMLKNPKIPPK----ARAVFR 79  Thermodesulfa...
Q5JH27           2 KFVLDTSIFVNPEVRKNFGDNPT-EAMKTFLSYAEKlfGKVEF----YMP-PGIYREVMHFVDSEELRPA----IELYII 71  Thermococcus ...
A6UVK7          83 KKTPNRYEIKLPAELLYEYIRDIRERINKGMRIGENAMYESASVSYLSikgcNsNQNdntkntknvdtnathkehTDEVL 162 Methanococcus...
A8A8M4          80 VKDVSQTEAKIPARVFLEYVAEVKRRLDKGLRVAEESTRRAMEGG---------------------------------EI 126 Ignicoccus ho...
Q9YBN4          88 VKPPTTHELRLPAAMFRRYVETVRARLDKGLRVAEDHVRRALRS--------------------------------RDEE 135 Aeropyrum per...
A3DL59          81 IRSPDLYTTRIPAIIMSDWIHDMLIRITKGLRVAEDSVRRAARRGYDYgvaqDkKGF-------------------EESV 141 Staphylotherm...
jgi:Pyrfu_0011  90 VKAPDKLSVRIPAIVMAEYVEDMRRRLMKGLRVAEEAVWKAVREAEKAravdEkRKQ-------------------EEFI 150 Pyrolobus fum...
B3DWH2          71 IRSPRKFNLLIPGSVLYDFIDEIRKRIDHGLRIAEEHLKLAGPDGG-----------------------------TPIPF 121 Methylacidiph...
Q0A5J1          71 VRSPRRFSMTIPAEILYEFIHELRGRIDRGLRIAEEHTRQAGAATD--------------------------------MR 118 Alkalilimnico...
A1WZ95          71 IRSPRRFSMTIPSEVLYEFIEEVRTRIQRGLRIAEEHARQAGQAES--------------------------------LP 118 Halorhodospir...
jgi:Thein_2060  80 VKSPKKYEIQIPAFLLYELIDDIRQRINKGLRVAEEAVRASAHKSP---------------------------------- 125 Thermodesulfa...
Q5JH27          72 KKPPNVHELKIPAFVVYELIEDIRRRIDKGLRVAEKAVRESVLDTD--------------------------------NV 119 Thermococcus ...
A6UVK7         163 SKTVKSFRNKYRTALRTGTLDSAPDLDVLLLAKELDAAVVASDEGIEKWAQRLGLRFVKAKDFPFILKEYLN 234 Methanococcus aeolicu...
A8A8M4         127 GEHIRNLREKYREATRKGLLDSVADLEAAILALELGAVLVTNDEGLCKLASKLGVSCIDPLTFVKTIEEYLN 198 Ignicoccus hospitalis...
Q9YBN4         136 GDIVRSLREKYREYTRKGMLDSVEDVDTLLLALELGAAIVTSDEGLRRAAEDLGLTVLTP---VELLEYILa 204 Aeropyrum pernix K1
A3DL59         142 AETIHELREKYREATRKGVIDTRVDFDLVVLAHEINGELVTNDTGIMKLCMQIGVKYIEPPRFINKLflllr 213 Staphylothermus marin...
jgi:Pyrfu_0011 151 GPIIRNLREKYREATRRGIVDSLEDFDVVILALELKAVLVTNDEGIKRLAETLGVIVVDPLTFVRMLRSYLE 222 Pyrolobus fumarii 1A
B3DWH2         122 DQLVNRLRNRYREALRQGILDSREDVDVILLAYELEAVLVTADEGMKKWADKMGIEILNASYLKDCLKNLIK 193 Methylacidiphilum inf...
Q0A5J1         119 PELIASLRERYREAMRKGLVDSREDVDAVLLAMELDAELVSADEGMRKLGNRMGVKLLTADYLRQVMENLga 190 Alkalilimnicola ehrli...
A1WZ95         119 PELITQLRERYREAMRRGILDSREDIDVVLLAYELDATLVSADEGMRKFAERIGIKLVNPRYLRGVMQNLag 190 Halorhodospira haloph...
jgi:Thein_2060 126 DEILNALRRKYREALREGIVDSKEDIELILLALELDGLLLSADRGILNLADKMGIRWIPPEEIRDTIEGLIy 197 Thermodesulfatator in...
Q5JH27         120 DNIIQKLRRNYRRALREGIVDSKEDFELILLAMELDATIVSADVGILTWAQKMGIKWVDSSVFREVLEGLVE 191 Thermococcus kodakare...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap