3G9W,4UM8


Conserved Protein Domain Family
Integrin_b_cyt

?
pfam08725: Integrin_b_cyt 
Integrin beta cytoplasmic domain
Integrins are a group of transmembrane proteins which function as extracellular matrix receptors and in cell adhesion. Integrins are ubiquitously expressed and are heterodimeric, each composed of an alpha and beta subunit. Several variations of the the alpha and beta subunits exist, and association of different alpha and beta subunits can have different a different binding specificity. This domain corresponds to the cytoplasmic domain of the beta subunit.
Statistics
?
PSSM-Id: 400871
View PSSM: pfam08725
Aligned: 58 rows
Threshold Bit Score: 57.5586
Threshold Setting Gi: 973177165
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3G9W_C         3 KLLMIIHDRREFAKFEKEKMNAKWDTQENPIYKSPINNFKNPNY 46 
EFX68653     556 RLLLFIYDRKEYAKFINESQNAKWTADNNPLYVEASTNYNNPAF 599 common water flea
XP_018671497 792 KILKTNYDKRKWEEFQAEVKKSKWTESNNPIHREAKQTFVNPRF 835 vase tunicate
XP_009860486 792 KVYQTWRDKREWKVFENEMKKSKWTKDINPVFQKPKTRFENPAY 835 vase tunicate
XP_011403560 723 KICLIMKDKRELKKFQSEVNDAAWADTANPLYVTPITDYQNVAY 766 Amphimedon queenslandica
CDS37993     800 KLVITIDDRRELAKFKMHNENVHWEMAENPIFEPPTTRVMNPTF 843 Echinococcus multilocularis
EEB11964     711 KIVIDFYDKREYEKFEREKHLAQWGKGENPLFKTPTKRYENPTY 754 human body louse
XP_686012    722 KGVLYASDLREWRRFEKDRKHEK-TSGTNPLFQNATTTVQNPTF 764 zebrafish
2_pfamImport   1 KLVIYTKDLKEFKKFEIEKKNSKWTDGVSPMFLSATTTIENPTF 44 
XP_018672461 792 KVYQTWRDKREWKVFENEMKKSKWTKGQNPIFEEASTRFENPTF 835 vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap