6T61


Conserved Protein Domain Family
Gag_p15

?
pfam08723: Gag_p15 
Click on image for an interactive view with Cn3D
Gag protein p15
Gag p15 is a viral membrane-binding matrix protein which is alpha helical in structure.
Statistics
?
PSSM-Id: 72147
View PSSM: pfam08723
Aligned: 3 rows
Threshold Bit Score: 210.061
Threshold Setting Gi: 1799709002
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6T61_A   2 GDPLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLFHDTNFVKEKDWQLRDVIPLLEDVTQTLSGQEREAFERTWWA 81 
Q9QGN7   2 GDSLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLYHDTSFVKEKDWQLKDIIPLLDDVVQSLSGQEKEAFEKTWWA 81  Equine infectious ane...
Q9QGK7   2 GDPLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLFHDTNFVKEKDWQLRDVIPLLEDVTQTLSGQEREAFERTWWA 81  Equine infectious ane...
6T61_A  82 ISAVKMGLQINNVVDGKASFQLLRAKYekktaNKKQSEPSEEY 124
Q9QGN7  82 ITAVKMGLQINNVGDGKASYQLLRAKH-----SKKQAEAPEAY 119 Equine infectious anemia virus
Q9QGK7  82 ISAVKMGLQINNVVDGKASFQLLRAKYekktaNKKQSEPSEEY 124 Equine infectious anemia virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap