2Z6O,3KPA


Conserved Protein Domain Family
UFC1

?
pfam08694: UFC1 
Ubiquitin-fold modifier-conjugating enzyme 1
Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes. Ubiquitin-fold modifier 1 (Ufm1) a ubiquitin-like protein is activated by a novel E1-like enzyme, Uba5, by forming a high-energy thioester bond. Activated Ufm1 is then transferred to its cognate E2-like enzyme, Ufc1, in a similar thioester linkage. This family represents the E2-like enzyme.
Statistics
?
PSSM-Id: 400850
View PSSM: pfam08694
Aligned: 28 rows
Threshold Bit Score: 268.392
Threshold Setting Gi: 126654536
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2Z6O_A        11 TRRVVSEIPVLKTNAGPRDR-ELWVQRLKEEYQSLIRYVENNKNADNDWFRLE-SNKEGTRWFGKCWYIHDLLKYEFDIE 88 
EDP02125       9 TKDTVKKIPFLTEKAGPRDK-EKWQARLKQELHALITYIKMNKESDTDWFTIQ-PNADGTHWSGKCWYVHELIKYEFDFQ 86  Chlamydomonas r...
XP_001778663   8 TTSTVQKIPLLSTRAGPRDG-EKWTQRRKEEFMALIKYMEMNKERDNDWFRIS-PNQDGTKWKGKCWYIHNLLKYEFDLQ 85  Physcomitrella ...
XP_018493454   8 TKSTLTRIPLLTTKAGPRDG-DAWKQRLKEEYKSLIAYTQMNKSNDNDWFRISaSNPEGTRWTGKCWYVHNLLKYEFDLQ 86  radish
Q4UGZ3         6 sHLSVEGIPLCKTNTGPFDNpEDWETRLNEEFAALIQYVEENKQNNTEWFTLD-CNDNGTCWFGECWYVHNMKTYKFQLE 84  Theileria annulata
EDO06978       7 TQTNTEGILQCSTNAGPVDApAEWEQRLNEEFNALIQYVEENKANDTEWFTID-CDDKGTKWFGECWHVHNMKTYKFRLE 85  Babesia bovis
ESS30807       2 sahGVEEIPVCSVSAGPRS--PEWKERLKEEYISLIAYISQNKRSDKEWFKIE-SNPEGTAWKGRCWYIHEMVKYEFQLL 78  Toxoplasma gond...
EEA07678       6 nRLIIDKIPLMSLNAGPNN--KEWNNRLKEELSSIIKYITLLKETGQDWFYIK-SNPQGTEWTGKCWYIYNMDKYEFDFQ 82  Cryptosporidium...
XP_001388438   3 nySTLEKLPQITINAGPLD--NLWPERLKEELKVLIGYVALLKDSGEEWFNIK-PLQDGTKWEGVCWYTHNLKRYEFAFR 79  Cryptosporidium...
EFN59335      10 TRATVQKIPLLTVKAGPREK-EEWQKRLKEELQALIKYIEISKAADLDWFTIRpSNKEGTHWSGKCWYIHDLIRYEFDFQ 88  Chlorella varia...
2Z6O_A        89 FDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQ 165
EDP02125      87 FDIPATYPDTAPEIEIPELDGKTVKMYRGGKICLTIHFKPLWSKNSPHFGVAHALCLGLAPWLAAEVPFLVESGAIK 163 Chlamydomonas rein...
XP_001778663  86 FEIPVTYPMTAPELELPELDGKTAKMYRGGKICLTIHFKPLWSKNCPRFGIAHALCLGLGPWLAAEIPHLVDTGVIQ 162 Physcomitrella patens
XP_018493454  87 FDIPVTYPATAPELELPEIDGKTQKMYRGGKICLTVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPILVDSGMIK 163 radish
Q4UGZ3        85 LEIPAAYPNAPFDIIIRSLEGKTAKMYRGGRICLDAHFLPLWQKNAPKYGIAHGLALGLAPWLACEIPHLVNIGVLD 161 Theileria annulata
EDO06978      86 INIPAAYPNAPPDIVLPDLDGKTAKMYRGGSICLDAHFAPLWQKNVPKYGITHGLALGLAPWLASEVPQLVAVGVLa 162 Babesia bovis
ESS30807      79 FDIPPTYPLTPIELRLPELDGKTSKMYRGGRICLDVHFAPLWQKNAPKYGIAHALALGLGPWLAAEVPYLVEEGTIv 155 Toxoplasma gondii VEG
EEA07678      83 FKIPDKYPLTPIEIELPQLDGKTEKMYRGGKICLDIHFIPLWAKNCPKFGIAHVLAMGLAPWLAAEIPYLIDSNIIg 159 Cryptosporidium mu...
XP_001388438  80 FNIPEKYPITPFEVEIPELDGKTLKMYRGGKICMDTHFIPLWLRNCPKFGIVHILAFGLAPWLAAEVPFLVSSCKi- 155 Cryptosporidium pa...
EFN59335      89 FDIPATYPATAPEIELPELEGKTAKMYRGGKICLTIHFKPLWAKNSPHFGVAHALCLGLAPWLAAEVPYLVESGAVQ 165 Chlorella variabilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap