Conserved Protein Domain Family
Med5

?
pfam08689: Med5 
Mediator complex subunit Med5
The mediator complex is required for the expression of nearly all RNA pol II dependent genes in Saccharomyces cerevisiae. Deletion of the MED5 gene leads to increased transcription of nuclear genes encoding components of the oxidative phosphorylation machinery, and decreased transcription of mitochondrial genes encoding components of the same machinery. There is no orthologue from pombe, and this subunit appears to be fungal specific.
Statistics
?
PSSM-Id: 370064
View PSSM: pfam08689
Aligned: 19 rows
Threshold Bit Score: 637.149
Threshold Setting Gi: 158513681
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P53114            1 MEKESVYNLALKCAERQLTSMEFSNLYKEFFNEKFPSL----------IQEEeedttttaninevkkasdlvDTPSNNTA 70   Saccharomyc...
XP_007695992      3 smVKEWTVLLHRCLERRVHSDVFAAAVAQLHAKSPLP------------------------------------------- 39   Bipolaris s...
Q4WNQ6            2 TSPVQWGTFFHQCLLHRIDANEFRNLSKLLLQKCPIA------------------------------------------- 38   Aspergillus...
Q5B503            1 MASEQWRAFVQRCLLHRIDAAEFRDLSMLLFQRCPIG------------------------------------------- 37   Aspergillus...
A3M022            2 SETVSLHKLVKKAVHSKLSFKTFLGLFSQLNTKQVVQDgeyqteileiVQNP---------------------------- 53   Scheffersom...
XP_002555516      3 enQDPIYSLALNCSRRRLPSNLFVNFYNELVNEKYGSM----------INSG--------------------EETDADIK 52   Lachancea t...
Q6CNY5            1 --mESVSQLVSNCASRGIPAQQFLNFYHELINEKYGAS----------LNAG--------------------NEERESES 48   Kluyveromyc...
ybcl:Ecym_3354    3 REVDSICKLITNCASRHVSPKQFTNFYNMFFNEQYDSV----------IESQ--------------------GDNEAKPP 52   Eremotheciu...
Q74Z26            3 RAQETVYDLITKCSVRRVPPKQFVNFYNEFFNERYDSV----------LENG--------------------NPAGESRP 52   Eremotheciu...
XP_001645383      1 MSSETVYNLLLNCAERQILASDFLNLYNEFYNEKFATK----------IENE--------------------NNEENQSK 50   Vanderwalto...
P53114           71 ATadtthlhEALDIVCSDFVKIL-NLEKPLILADYIVEVLL---VNYNSDMIK--CFLPKLNSVRNSLLLAHFFSKSCSF 144  Saccharomyc...
XP_007695992     40 ----------------------------GRKLAALLLRPRVadnSNIDPRIVIylEQLLSLKKLDASDVLIVALLYSKVR 91   Bipolaris s...
Q4WNQ6           39 ----------------------------ETALLDALLQTRSesrIKWDPLLPLyiDCLCRTGRVRTSTVLTSLLKYSSIH 90   Aspergillus...
Q5B503           38 ----------------------------DLLLTETLLQARLatgIKWDPLLPVyiDCLCRMGRVQIPTVLTALLKHSSIH 89   Aspergillus...
A3M022           54 ------------------------RNLNDKKITEYKVVLAIqlsLSSSEELKRfwGNLSKISLVGQVDYLIRL------- 102  Scheffersom...
XP_002555516     53 QT-------NVCEKISSSLLRLL-DAEKHFLIVDYVVEVLF---INYNKELVK--ELLPQLYSIKDSSQLVLFLSKASAF 119  Lachancea t...
Q6CNY5           49 RK-------QVFEDVSRELVQAFhSSEDAILLAEYMVHLLF---INYDTYLSS--ALLPQVYSIQSETLLMHFHSLAASF 116  Kluyveromyc...
ybcl:Ecym_3354   53 IE-------PVYEAISQGLLKVL-NDGKYNLVADYVVEIVF---VNYNSELLK--IFLPKLHLVKNQLVLIHFFSRSTGF 119  Eremotheciu...
Q74Z26           53 TA-------PVYEEVAQDLVRIL-NDSRVNLVADYVLEIVL---INLNVDLLR--LFLPKLHHVRNVMLLVHLFSRATAF 119  Eremotheciu...
XP_001645383     51 VV-------EISESISSDVIKLL-NSGNRLLLADYVVQLLF---VNYNSDLVQ--ALLPKLYSVSNEFMLVHFFSKSCSY 117  Vanderwalto...
P53114          145 ----------------------FAKLSDTLIIDQVRKDLGNVIVPNI----------------LSLDMNSMNKELIAIVS 186  Saccharomyc...
XP_007695992     92 lpvkteek------sskdaqwsNPPELEELIFHRLHKVFAAEERPVN---------------------NVEGVHTLAVVA 144  Bipolaris s...
Q4WNQ6           91 dkpqlsts------egkdgskcYTLMTDIRVIQDTMLSVSTGSTPKT---------------------NAEAVAIFFAII 143  Aspergillus...
Q5B503           90 dkpspgadvasvkknakprakcYTLMTDIRVIQDAMLSINSGTTVKT---------------------LLEVIHTFCAIA 148  Aspergillus...
A3M022          103 ----------------------NKIL--KYEYSKYDKDIVRLLIKVQycdyivevldsfgdkkLSTEQKSLANHIVFFAS 158  Scheffersom...
XP_002555516    120 ----------------------FLRLTDKLVIDQICGDLGNVIVPSI----------------LSSSFNTQGEELIVAIA 161  Lachancea t...
Q6CNY5          117 ----------------------IGKLEDKLIKEQMRQDLSTFILSSC----------------LQCDMSTFNNQLFISIV 158  Kluyveromyc...
ybcl:Ecym_3354  120 ----------------------MRNLTNKLISDQISNDIYSDILPSI----------------LSFNFSELGDELITIIT 161  Eremotheciu...
Q74Z26          120 ----------------------ISGLDNKLLAEQISDTVYTDVTPAV----------------LSFNMQAIDDQLVIVLA 161  Eremotheciu...
XP_001645383    118 ----------------------FAKLSDKLIVDQLVKDISRSIIPGV----------------FAMDINIMTNELVISVS 159  Vanderwalto...
P53114          187 KLLQTTLKLSPSP--I---------LLTSAGCKNGSFTLLNQLSQTNKLLF-----------KRVSQTFEAKLHFKDTKP 244  Saccharomyc...
XP_007695992    145 RWMQAMVTSHTSDtmIqamagiqqpQQQSINVREGLAMLVVGVIENSKILRilnhpkakevrKELTKSLSSFIPFLSNNS 224  Bipolaris s...
Q4WNQ6          144 DWIHAVASWHNSHfdPgqhssgimsSPDVVSLFESLGILLAALSGTGKGLEvlsadsheglkVKLGQALSAYLPLCVE-- 221  Aspergillus...
Q5B503          149 DWIQAIIAWHNSQldAdqpa-gmmgSPDAMLLFEAVGILLSVLAGTGKGIEvlsagpheatkIRIGQALSAYLPLCAD-- 225  Aspergillus...
A3M022          159 SVIEHVVVKDEAL--VndlvfqlatRLEGLRLSNLLDFLLLKSKNI---------------------------------- 202  Scheffersom...
XP_002555516    162 KFLRNVLSLSSNP--I---------AISDPKVGDRVRELLNCLSKINRLLY-----------KKVAGDFDSLLRLGGSAP 219  Lachancea t...
Q6CNY5          159 KYLQALLTLIDDSidI---------EMDKDNLKLAVTSLLTRTTKLNRILG-----------KRIGREFETKLNL----- 213  Kluyveromyc...
ybcl:Ecym_3354  162 KFLHTVLKISESP--A---------KIQDENIRNNGNLLLQRLSKCNKLLY-----------KRLFNDLDPKFQAGEPSS 219  Eremotheciu...
Q74Z26          162 KFLHAVLRLPEGQ--Q---------KMGSVPTKQKAATLLQRLSTIDRLLY-----------KRFIADLDGKLRLSGAPA 219  Eremotheciu...
XP_001645383    160 KFLQLILNFLPKP--I---------VLASETDKDHLYLLIRRLSQINKLIH-----------RKFSQTLESKMIFKDSKP 217  Vanderwalto...
P53114          245 FL--NKDSTNEFVGSPS-----------------------LTSPQYIPS----PLSSTKPPG--SVNSAA----KYKDMK 289  Saccharomyc...
XP_007695992    225 VGsqTSLSLANRLEISQkqhdlyeklpnvngegnesagleVAALQLDAVme-lPQANTRAGL------------------ 285  Bipolaris s...
Q4WNQ6          222 ----VSLPLRNRLDGLQkefnlygervpksldvpmmenmnVNALQFEASvmdgPVINSRAGL------------------ 279  Aspergillus...
Q5B503          226 ----MYPPLHNRLDGLQkqfnlygqpps-kldvtmmdnvnVNALQFEASvmdgPTIHSRAGL------------------ 282  Aspergillus...
A3M022          203 ----LSEDQIRLTDSSG-----------------------SGEDK--SS----DLPTITTSLykNLSVGSlssaKQETYN 249  Scheffersom...
XP_002555516    220 P---TAREERHGVSSPS-----------------------IISPRYLES----PINVTKQP-----QSLIpssvNHQTVK 264  Lachancea t...
Q6CNY5          214 ----SLSAKLAMVNSPQ-----------------------IFSPSSGATrfagTPGSTK-PMdlALSATSstsnKIQDLK 265  Kluyveromyc...
ybcl:Ecym_3354  220 SVg-TFALPPSTIPSPS-----------------------VTSPKYESI----TVGVTKQP------SLApnelKYQDVK 265  Eremotheciu...
Q74Z26          220 DM--SFPLPPSNMPSPS-----------------------VTSPKYETS----SVGVMKRS------TSMsneaKYQDIK 264  Eremotheciu...
XP_001645383    218 LF--ATTATTPFINSPS-----------------------ISSPQFIPS----PMVPSKQGP--SAEASM----KYKDMK 262  Vanderwalto...
P53114          290 LLRYYKNIWLNNKIINWEIS-NPDFLSKYSAITSSIFQESF-NSVQNLDQLLTDLIETSFTCFAQFVSNKQYHQANSNLT 367  Saccharomyc...
XP_007695992    286 ------YVFLNSLLVARPLT-DDFVIISHLH---TRYKLEP-------QNMATELITAAF----DILANAMYRNEPTQTL 344  Bipolaris s...
Q4WNQ6          280 ------YVFINAMLVGRPLV-DDGMLINYLA---NRYGGHY-------EALVEEILTASF----DVLSNGMYRNESSRMM 338  Aspergillus...
Q5B503          283 ------YIYINAMLVGRPLV-DDSILLNYLY---NRYAEHY-------DVLIEEIITASF----DVLSNAMYRNESARTM 341  Aspergillus...
A3M022          250 ETI--KFLWLNKIMKSWKFAdNESIFNNFVH---NFIPSSD-KN-KNPYLTSFELIKATFKGFGYAVINN-----DDCYV 317  Scheffersom...
XP_002555516    265 LARYCKNLWLNSRIMGWRTN-DVAFVTKYSKIEAEIMKKTS-PSQLNVEAAMKDLIETAFTSFAQFVSNKQYHQANSAFN 342  Lachancea t...
Q6CNY5          266 LIRFYKNLWLNNKIHHFNTS-DSQLLEKFSSIN-SRLSSSL-AEEHLIQEQITDLIETTYTSFAQLVNNKLYHQTNTNFN 342  Kluyveromyc...
ybcl:Ecym_3354  266 LTRYYKNLWLNNKIHYFTVS-DPDFLNKYESIGELTKTSGSpQIERSSQTNVADLIETTFTCFAQFVSNKLYHQLNSNFS 344  Eremotheciu...
Q74Z26          265 LARYYKNLWLNNKIHYCTVS-DPLFLEKYDSILELATGGGL-SADRPVKAKIADLVETAFTCFAQFVSNKLYHQSNSNFS 342  Eremotheciu...
XP_001645383    263 LLRYYKNVWLNNKIFNWECT-NPDFLSTFSSIVTGLFQFQT-SSRLTTDELLTDLIETSFTCFAQFVSNSQYHQTNATFN 340  Vanderwalto...
P53114          368 LLERKWVIFITKHLPLLILE----NSSRSP-------RVVTNALDNIDEKVVKAIRIYFTEKDDNKTNNEDLFDDYPSTS 436  Saccharomyc...
XP_007695992    345 FYLKS---FLINKIPTLL------TQISGSifpmtveMCITQALSHVDP---NAFPSFSQGFDDIMGSNNSL-------- 404  Bipolaris s...
Q4WNQ6          339 FVFRS---FLVNKLPPFFA-----AMLASTmvsipmeMCISHALSRLDP---NTFPSFSQMFE--MQGNTVL-------- 397  Aspergillus...
Q5B503          342 LLFRS---FLVNKLPPFFA-----AMLAVPmvtfpmeECISHALSRIDP---NIFPSFSQMFS--MQGNAAL-------- 400  Aspergillus...
A3M022          318 LF--NWKNFIITRIPVILSTlkfaNVNDeet----leRAVLNAFNSLPDSIVKVLTNLASGSTKV--------------- 376  Scheffersom...
XP_002555516    343 LLERQWNIFITKQLPLHIME----NASDMP-------HIVINALENIDHKVVKALKSYASDKDDAKNRGEDLFDDLPNKN 411  Lachancea t...
Q6CNY5          343 LLERKYVHFITKRLPLIIKD----FLPQNP-------SVIVNSLQNIDEKVKKAIKSYYSNKNDSPERNEDLFDDYSGNN 411  Kluyveromyc...
ybcl:Ecym_3354  345 LLERKWTIFITKQLPLIIKQ----SIPNEP-------QLVLHALENIDDKVVKAIKSYNTEKDEVKNRTEDLFDDYPVNN 413  Eremotheciu...
Q74Z26          343 LLERKWTVFVTKQLPLIIKS----SIPDKT-------DIVLRTLENIDDKVIKAIKSYNTEKEEVKNRTEDLFDDYPVNS 411  Eremotheciu...
XP_001645383    341 LLEKLWIIYISKQLPLLILE----NSTGNP-------TVVTRALERMDDKIIKAIKSYYAEKNDQRNRNEDLFDDSPSSG 409  Vanderwalto...
P53114          437 LDIRHDFIKGLIMLNLQPASVINNYLREDQMIDTSILPTRDDLFVRNLQGIQEVVHNTNSF------IISSLDTLELESI 510  Saccharomyc...
XP_007695992    405 SDVRQDYLNACVLHGLLPAGTVERLLGEAPM----------QGPPAKRYERKELFNQCKLNfdkvsvYIDELENLDGNAG 474  Bipolaris s...
Q4WNQ6          398 SDVRQEFLFACASHKLIPESSIERLLGENPM---------QTLPVG--YNKDELVSQINANperaeqLINEIESMEGNAG 466  Aspergillus...
Q5B503          401 SDVRQEFLFSCASHKLIPESSIERLLGENPM---------QTLPVGGSYMKDELKAQISANheraeqLISDIESTEGNAG 471  Aspergillus...
A3M022          377 YDLRQIFIKSLIFNRLLPPVAFQKFFPMESKI-------TQQVILSELAQYNHDLNLRRKFndklinVNSEFTSLEe--- 446  Scheffersom...
XP_002555516    412 TDIRHDFLKSLIMIGLQPAAVLNDFLREDQVVDTKSLPTNDTVVIKNAQGVKETVDNFSQF------IKDTIEDLDAESM 485  Lachancea t...
Q6CNY5          412 FDIRHDFLKNLIMLNLRPPSVLNEFLREDQMVDVKTLKTDDSLVIVNSQGVQEKVSDVQEA------LKSLIADLDIENQ 485  Kluyveromyc...
ybcl:Ecym_3354  414 LDIRHEFLKNLIMLGLQPPNVLNEYLREDQMVDLKSLVTSEHLVIENSQCVKESILDIKGF------MKRSIETLDFESM 487  Eremotheciu...
Q74Z26          412 LDIRHEFLKNLIMMGLQPPTVLNEYLREDQMVDLKSLVTSEHLIIDNSQGVRETILNVRNF------ITKSIESLEFENL 485  Eremotheciu...
XP_001645383    410 LDIRHDFIKSLVMLGLQPPSLINDYLREDQSLDPRTLTSSDALVITNIQGVLEVIRDVNTF------VLQTLDSMELENI 483  Vanderwalto...
P53114          511 TeSITHDSS----NGLFQVLHNFESV---APTKQREIVKAFLSIFEDAIKELNYNRIAKICALLFFNFSHSLTTILSFSS 583  Saccharomyc...
XP_007695992    475 A-----------------------------------IVAAIADFISHLCDTQTTMYLKQLCCLI-FKKPQAMDVMLQFTS 518  Bipolaris s...
Q4WNQ6          467 A-----------------------------------IIGAITEVMHNLCNQKETMTLKNICNSL-SRRPQALDVVLIFRN 510  Aspergillus...
Q5B503          472 A-----------------------------------IVGAITEVMHDLCMQKETMTLKNICNSL-SRRPQSLDVMLLFRS 515  Aspergillus...
A3M022          447 -------------SGLLELCNSLPASleySYSRQIELSNAINDIIDEMKISREHEKLNRLLLSVMSNV--QLTNILVFNS 511  Scheffersom...
XP_002555516    486 F-EATDGSLgnadNGIMQILRKFETL---AATKQKDLANVFYDLFRESVSSFDCKTFSKTCCLMCFNMSHSLTTMFAFVN 561  Lachancea t...
Q6CNY5          486 YvANGNNYRfspdNALLKLLMSFDTI---APTKQVEIANAFLQILQKATDTSDLKTLGKVLWILTSNVGHSTTSMLCCIS 562  Kluyveromyc...
ybcl:Ecym_3354  488 F-DDSNQLVigtdNGLLQLAHNLESV---APTKQQEISNIIYDVLRKAVEDFDHKSISKILTLLTLNIGHLLTNILCFIG 563  Eremotheciu...
Q74Z26          486 F-DDGNQLLvtndHGIIQIAHNLETI---SPTKQLEIANILYDLLSAAIESLDHKTISKVLTILTLNVGHLLTNIFCLTG 561  Eremotheciu...
XP_001645383    484 N-NSSDVTN----NGLKQVFINFETV---SPTKQREISNAIVSVIKDSVDQLNFQRLSKICALLCYNFGHSLTTIMLFVK 555  Vanderwalto...
P53114          584 -PAALMKTLIKFVDLSRNGRNGSNGND--ESSEYETINISLSFSWAILLIINLTQTYGISVVDVALKYP-ELSIKNSFII 659  Saccharomyc...
XP_007695992    519 -PASILRPLCQFLE-DWHy----------DSDQGEYQPVYDEFGAILVLIMAFVYRYDLVCHDIGIAH-------DTFIA 579  Bipolaris s...
Q4WNQ6          511 -PKQVLQPLCALLD-SWHw----------DEDQGEYQPVYDEFGSILLLVLAFKYRFDLRPADLGISSS------DSFVL 572  Aspergillus...
Q5B503          516 -PRQILQPLCALLD-SWHw----------DEDQGESQPVYDEFGSILLLVLTFKYRYDLRPWDLGIASN------DSFII 577  Aspergillus...
A3M022          512 nPYVVLGKMIDYID---------SENFriDDDDENFQDVYSYCGVLILSIISIIEKFKIDLSTFNIKNSfALDYINNFYY 582  Scheffersom...
XP_002555516    562 -PQKFLAVAIEFVDQIWESSVRKASAGlnDESDFEPNTEFVCFTYALIFIVQVVGTYNVSLIEALSTSS--SDPQSSFIV 638  Lachancea t...
Q6CNY5          563 -PGPFINAVVKFLEKQQRNSTVSSs----DEPDFDSLHSYVTYGMALSFVVFLKTTYDFDIEPFIQNFE------ESYTL 631  Kluyveromyc...
ybcl:Ecym_3354  564 -PEKLLGPVVTFIDVIWEPNGNKLNDVisEDSEFENLSAFMAYTLSMAFIIHMVKTYNVNLESLVEIPS------KSTVL 636  Eremotheciu...
Q74Z26          562 -YEKFARAVIRFIDVIWESNKSKSNDMvsDDSEFENINSAMAYTLSLCFIIHVVDIYGVNVEALVENPS------KSTVL 634  Eremotheciu...
XP_001645383    556 -PTTILELLMKFTDISWDQFVVSKSSs--METDYELTSSYLAFGWVTLLLTTISKSYEISLVDIALNSS-FLVSKDSFAI 631  Vanderwalto...
P53114          660 NFISNLPN-VSDKYYLEESNVNDSDMLTKSHNTVQSWLCDLF--VNGSITDQLIQNIETRQLANLIPFIVKQVLLSVEIG 736  Saccharomyc...
XP_007695992    580 KLLQHGHHsIPP-----------DELTEEQGGHLGSWLKGLYdsDKEGLSNEVFASCRPQDFYLIVPTLFHQTVAACSLG 648  Bipolaris s...
Q4WNQ6          573 RLLERGSC-----------SQKLDALDEKQNKNLGSWIAALF--IAEGISEETMSACSPQEFYLLVATLFSQSLEACETG 639  Aspergillus...
Q5B503          578 KLIEQGSS-----------SQKLDELTEKQNKNLGEWIAALF--IAEGISEETMSACSPQEFYMLVSTLFSQSLGACEAG 644  Aspergillus...
A3M022          583 RLCDDLTNqIPV-----NSDEEDNTIATNYNNLLIDWINALFddSNDGLSDDLIKSISIKQIYKLIPLVYQQAITATSIG 657  Scheffersom...
XP_002555516    639 NYITKLGD-IAPALKLNST--------LDSSEVLKSWVRDLF--INGSISDSLMKSANVKDLAVLIPFIFKESLSAVESG 707  Lachancea t...
Q6CNY5          632 KFLSSIED-ISDIFVLQNESAE------GSKLYLQNWLRDLF--INGSISDSQMKNTNVKDLINLIPFIFKQSVIAVQAG 702  Kluyveromyc...
ybcl:Ecym_3354  637 NFISKLGD-IQETFS-DEGNPD------ASKNMLQLWLRDLF--INNSISDPLMKTADVKVLGTMIPFIFKQSLVNVETG 706  Eremotheciu...
Q74Z26          635 RFLSKLGE-IPEVFVAPEGDLE------SSKTLLQQWLRELF--VKNLISDNLMKSADVKVMGFMIPFIFKQTLLNVEYG 705  Eremotheciu...
XP_001645383    632 QAVSKIYD-IPDSFTLSKGGKTDND---EDSQEMRKWFQDLF--VNGSLSDSLIQNVDVKKLIDLVPYIFKQVMLGIENG 705  Vanderwalto...
P53114          737 VLTDISSLIGGFEYFLQPLLLVGLIKTFYWLEQF-LSCVKNDTISEDILQGIFNLLNTLFNPVTLNED-----SKAFHTA 810  Saccharomyc...
XP_007695992    649 VL-SFETVKGGLEYLGETFLMPSLIGGLTWMASYaLLQTHND------LDAITRIFNAILLSAPSSGD-----AQAMHST 716  Bipolaris s...
Q4WNQ6          640 KL-EFDTLKGGFEYLLEPFLLPSLIFALTWLGDH-IWEMELDPSIP------LKVLHSLVNPSSISGE-----AREIHRT 706  Aspergillus...
Q5B503          645 KL-EFDTLKGGFEYLLEPFLLPSLVVALTWLGNH-IWESEADPTIP------LRTLQSLVSPSSISGE-----AREIHLT 711  Aspergillus...
A3M022          658 KI-DFSILTNGIDYLSQVFLIPTTVSIINWL----LSEISNKKTDAESLP--VKVLSEIVKSNISSESgsqelSSLVFKI 730  Scheffersom...
XP_002555516    708 SIRDISALVGGFEYFLQPFLIVGLIGIVFWTEQY-LTTLRSKDLAKDLLESIFDMLNSVLNPSTLNDE-----SRPLHTL 781  Lachancea t...
Q6CNY5          703 VVSNILNLTSGFEYFLQPFLMPGLIKIMFWLEYY-LHSLKNNNPPSQILSSCWELINILICPPSLDDD-----AKGLHFM 776  Kluyveromyc...
ybcl:Ecym_3354  707 LISDVSNFVNGFEYFLQPFMSIGLLNIFFWLEQH-LISLKTDDSFLQIGGKIFDLLNAIIAPKGMNPD-----AKAVHYV 780  Eremotheciu...
Q74Z26          706 IISDISSFVNGFEYFLQPFLSVGLINIVFWLEKY-LLALKTTESFPKINGALFDILGAIIAPKSIGSD-----AKAIHSV 779  Eremotheciu...
XP_001645383    706 VITDMSRVINGFEYFLQPSMIIGLIRIVYWLEDY-LESLKANGIADDIIQKILSVVNSLLAEVSLNSD-----SRAYHES 779  Vanderwalto...
P53114          811 VLRLNAIPLLKVLRKFRV-Q-SQSNYGIYSSDAQGDPNLEPLIAKLVAVLNVSPVYDVDPRIINS-ENDYSR-KQLGYGK 886  Saccharomyc...
XP_007695992    717 IIAMVSSRLEKCFRTLQRrEpNRN--------------------------NLDSFLQAIKVHTHYeRTVFATmKEL--DQ 768  Bipolaris s...
Q4WNQ6          707 VLNIAARTLEEQLKDVRTrHpSRT--------------------------DIKPILDSLEPCLSFqLVGSSHrSEL--EG 758  Aspergillus...
Q5B503          712 VLNITSRSLEEQLKDVRArHpTRT--------------------------DIKPILDALDPCLSFqRTASCHkSEL--EP 763  Aspergillus...
A3M022          731 VVNICGSNILIALKKIKDwE------------------------------NSQRIRDVVSIVTANlDSNYVE-KDLSLPE 779  Scheffersom...
XP_002555516    782 ILRLNTVQLLKATRAFQT-Q-TQSSYGTYSSDSEGSTKVDSLISHLEQVARSSILYNVDSSVINS-EIGYQR-KDINYTP 857  Lachancea t...
Q6CNY5          777 ILKLNCVRLLNVLYLFRNdEsNSSQYGVYAAHESIDPKLEAVISKLEYIASISNIYDVDTKCYETtKEVYSH-GTLFSNK 855  Kluyveromyc...
ybcl:Ecym_3354  781 ILKLNCINLLKELKSFQVs--NESNYGMYSSQYQQDPKLDSLISKLESVAQSSNIYDIDPRITTAtGNSYSQ-KQISYNK 857  Eremotheciu...
Q74Z26          780 VLKLKCVGLLKELKSFQVp--SESNYGIYSSQTRQDPRLEALISKLELIAQSSALYDVDPRIISAvNNNYSQ-KHISYNK 856  Eremotheciu...
XP_001645383    780 VLRLNAPNLLKAVRSFRI-Q-TQQNYGIYSSEAQGPPVVESLISKLVLVMNISPVYNIDPRVSVS-DNSYSQ-KQFGYRN 855  Vanderwalto...
P53114          887 FLILNENPINKIMTNQINSF--WSLHSS-----TYYNLDYLFELIELVTPKSFLFDVLKTLEYKLATYGVPGSENKRGSL 959  Saccharomyc...
XP_007695992    769 WTNAPNSTLNTSLRHTVQQLsqWASTASmqpnpPSYTHRQLYASLKMLGAARTLRAIVDELKTQTDS------------G 836  Bipolaris s...
Q4WNQ6          759 WTTHSSGGLLGSIRSTFQSLvlWSTNPEvsmapPPYTHRQLIAGVRMLGASRVLPALIEELKLQTEA------------G 826  Aspergillus...
Q5B503          764 WTTHNPGGLLGSIRATFQSLilWSTSPDvsmapPSYTHRQVITAIRTLGASRVLAALLDELKFQTES----------NPG 833  Aspergillus...
A3M022          780 --SKSDININEQIKSHLVNF--QQQADS-----PTPIHAFIHRFISDSKDQ-----VLRVLLQEVTSY------QKQNNE 839  Scheffersom...
XP_002555516    858 FAITADNSINSILTNQVNSF--WNLHSS-----TYYNIDYLFALIDIITPQRFLEDMLVVLQHKTTDAALPNSRTKGSDG 930  Lachancea t...
Q6CNY5          856 IPVTNEHPIDIIMTNQLNSF--WNLHSS-----TYYNYDYLLELIKLITPEKFLVDSIRTLTYKVAAYGIPGVQGKLNTS 928  Kluyveromyc...
ybcl:Ecym_3354  858 LTMTSDLPINKIMTNQINSF--WNLHSS-----TYYNFDYLLELTNLVTPAQFLHDVFESLKYKVSTYGIPGSVNRPPAT 930  Eremotheciu...
Q74Z26          857 VVLTSDIPINKIMTNQINSF--WNLHSS-----TYYNFDYLLELIDLVTPFKFVQDVFQTLKYKVTAYGVPGSATKPSSA 929  Eremotheciu...
XP_001645383    856 FLILSEQPLDKILSNQINSF--WSLHSS-----TYYNIDYLKKLIDIITPKKFFIDVMKTLDYKLSAYGVPNVRNKIRDV 928  Vanderwalto...
P53114          960 DSEHVFDYFFYFLVLYDVKTAEEASQLIEYMEndakkSKGDVDIKGEDLHEKndsaevrqetqPKAEATQ-----DDDFD 1034 Saccharomyc...
XP_007695992    837 NGAAALDVGVSIVCAPTVEDSPISVDWVGs-------TVPAPTPQRTRMNLR-----------EMLKQDFdnaasLVATD 898  Bipolaris s...
Q4WNQ6          827 NGPLALDLAATLICAPMAET-----FSVEQNShqpvdPNKEALPRCGILTLR-----------DVLALQHenvpkISEKD 890  Aspergillus...
Q5B503          834 TAGIALDIAASIVSAPLSES--FAFDQFQTHHdhstsKESEQAPHYPIFNLR-----------DALNTQHelvpkLSEKD 900  Aspergillus...
A3M022          840 ATKIFINLASYLVVSSSIDSVEDKKYWHGYLSnvsssATEHKI--------------------LKNSDKEfnssmDYHYS 899  Scheffersom...
XP_002555516    931 ENLFYLDYFFYFLVSHDVMKAENKTDILQYMSstaesDLIFRKPAHEFQPS------------AKVEQPS-----DEDFD 993  Lachancea t...
Q6CNY5          929 AIEQVANFLAYFMILHDVQTEEQRLALLNYIEsgvivSKETETKQEPETKL------------------------DDDFD 984  Kluyveromyc...
ybcl:Ecym_3354  931 ALDHVLSYLFYFMVLRDIKNPEEKSALLEYLEtgkfsSAIIRNKIKTDSSSIlgssa--pqadNKSDQDPvd-aaDEDFD 1007 Eremotheciu...
Q74Z26          930 ALDQVLGYVFYFMVLRDIKCPEEKSLLLEYLDsgrfpSSISATVLTSDPTTIsgmppvsmpydVKSEQDAme-gvDEDFD 1008 Eremotheciu...
XP_001645383    929 DAEHVIDYLFYFMVLHDVNSQQEASEMIMWMDk----TLKDADNSAETSTSKtk-------ipNKAEQQSl---pDDDFD 994  Vanderwalto...
P53114         1035 MLFGEN----------------DTSTQAYEEEEenedndgnnrtnnvpmIkAe--eTPSKTNKISILKRHSFAVLLH--- 1093 Saccharomyc...
XP_007695992    899 PLTAETivrlhrrveahftslaESGLQAPPINIp--------------------------SVNITDMQSQSISEHLN--- 949  Bipolaris s...
Q4WNQ6          891 PLRAEVlvrl---------yrrvNALLAPPSQVp----------------------NLDVNNIIQNMQLGGVGVGAG--- 936  Aspergillus...
Q5B503          901 LLRAEIivrl---------yrrvNTLLAPPAQVapnldmn---------mgmnvnvNMNMNNIIGDMHLDSSGDGASnqn 962  Aspergillus...
A3M022          900 SIFNDA-----------------SSGASNDDDLfndkssk---qlssgkLlEqlrtKVNRYNNLLAKFNVIFA------- 952  Scheffersom...
XP_002555516    994 MLFGE-----------------DTSIPGNESEAnineikadeispinpeF-----------------LRCSFAAVLH--- 1036 Lachancea t...
Q6CNY5          985 MLFGEPfnn----------tldETSLVFSQNEQ-----------------------PKSYSSSVFPVLHDTFGVVIA--- 1028 Kluyveromyc...
ybcl:Ecym_3354 1008 MLFGESfsglpdesqkpndikhESGLKDENSE-------------------------TLEPRVSLVRLTESFGFAYF--- 1059 Eremotheciu...
Q74Z26         1009 MLFGESfsglpddvqksadmkpDTGIKEDDSE--------------------------KSSYVSAARLTESFGVIFS--- 1059 Eremotheciu...
XP_001645383    995 MLFGEN----------------ETSMQGTDEEDami-----------vdIe-----TCQNLNNIAVLKKNSFATVLQ--- 1039 Vanderwalto...
P53114         1094 ---ERKLLNDLaLENGEITKTENEKFISYHDKYLCML 1127 Saccharomyces cerevisiae S288C
XP_007695992    950 ---RAMDDAAAaSMVEDISNMDNKALQRSMDELASTE 983  Bipolaris sorokiniana ND90Pr
Q4WNQ6          937 ---QMELDA-TgAADHGVGPDDAENIHRMIDNaaaaa 969  Aspergillus fumigatus Af293
Q5B503          963 mnmNMETDTRTqAQEQGHNNEQA-NLNQIMDNAAaav 998  Aspergillus nidulans FGSC A4
A3M022          953 -------------ENQDPSSPWHKTVNTLADKLLDDI 976  Scheffersomyces stipitis CBS 6054
XP_002555516   1037 ---CSLLANKAaLESGHTSEVAVDQLTQLHDKYIEIL 1070 Lachancea thermotolerans CBS 6340
Q6CNY5         1029 ---EMKKRYDTsKNNGLLSEAAYENATTFIRKYVENL 1062 Kluyveromyces lactis NRRL Y-1140
ybcl:Ecym_3354 1060 ---MMMKDTKEaYDAGQETEPRYENFINLYNRYVETL 1093 Eremothecium cymbalariae DBVPG#7215
Q74Z26         1060 ---KMKKDKLEaYQAGQISEERYQCFMGLYDKYVQTL 1093 Eremothecium gossypii ATCC 10895
XP_001645383   1040 ---DTKYLLDAgLVSGDITKEEYEKGCKYHQKYLGLL 1073 Vanderwaltozyma polyspora DSM 70294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap