3HC1


Conserved Protein Domain Family
HDOD

?
pfam08668: HDOD 
Click on image for an interactive view with Cn3D
HDOD domain
Statistics
?
PSSM-Id: 400828
View PSSM: pfam08668
Aligned: 53 rows
Threshold Bit Score: 146.973
Threshold Setting Gi: 75354298
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3HC1_A  26 LPTVPDIVLRIAGKLNDPDVAIDEVADLLLQDQVLTARVVHLANSPLYS--AARPIS-SIRDAVI-YLGLDLLREAIFTC 101 Geobacter sulfurreducens
Q47F47  17 MPAFPRVVTEIIATLDDDGATLGALVHHVERDPVITARVLSIANSAAMAghSGSDVH-DVRKAVS-LIGLQKIREITLAV 94  Dechloromonas aromati...
Q2S8R9 193 MPPLPETAQRIIKLRVDPEAGISELADIVETDPSLSAQVVSWASSSFYA--APGKIR-SVHDAIVrVLGFDLVMNLSMGL 269 Hahella chejuensis KC...
Q2SKE1  26 IPMLPEVAQKVIAITTNPDSGASELVKVIQGDQALAARVMRIANSVAYS--PNASIV-SLQQAIA-RLGMVSIRDIALAA 101 Hahella chejuensis KC...
Q9I6M3 161 APLLADVRAASDRCLSAEEHPLRVLEAEFGRDPQITAGLIAAANSAARH--VGPACQ-TLGQALR-RLGLGHSLNLVLGF 236 Pseudomonas aeruginosa
Q88AT3 163 aPLFVDVATAVKLSQTANGIDVALLEQELRNDPHITAVLIAAANSAAQH--LGKPVQ-TMGGALG-ILGPVQGANIASGL 238 Pseudomonas syringae ...
Q88RB8 159 gPLLADVQVAINRALNPQGLNLRVLEEEVRNDPQVTAVLIAAANSAALH--REAPVQ-TLLQALN-KLGSTQSMNLILGM 234 Pseudomonas putida KT...
Q5E6F6  39 LPPIPDVVLKIQKLCTLEGTMIKDVSDTLLEDPSLTAIVIRMANSVVFN--HRNITCtDVLTAVS-RLGIFRVRDIVTAQ 115 Aliivibrio fischeri E...
Q2SA21 160 LPSLPDMAMRIRHVTEQPNFHLNDIAKVIVRDPVLTAKLIRSANSPLYR--GFKEIE-CCEDAVV-RLGLDTTRQLITIF 235 Hahella chejuensis KC...
Q3J8D7  32 LPTLPEVALKIREVVDDPNTSAADVAKIIVTDTALSVRLIKIANSPLYR--GRHPIN-NVQTALA-RLGTALVRNLVTSL 107 Nitrosococcus oceani ...
3HC1_A 102 AIVDLFKTGK----GPLNRSTLWAHSLGVARIAKLIAERT------GFLN-P--VNVYVAGLLHDVGEVFINFFRGKEFS 168 Geobacter sulfurreducens
Q47F47  95 SLAEFAHGCR-------MASYFWEHSVAVGICALELARFT------HQPS----GYALVAGLLHDIGQLWMAHFHPLEFQ 157 Dechloromonas aromati...
Q2S8R9 270 ALGRTLEVPEe---RGDGFTPYWEQSVWTATLCGALTTAI------PKERrPefGLAYLVGLLHNFGYLVLAHVFPPHFS 340 Hahella chejuensis KC...
Q2SKE1 102 SINARMFKAPg---YEDRIGSMWRHALATALWCKEIARRA------RMNV----EAAFLCGLLHSVGKPIML-------Q 161 Hahella chejuensis KC...
Q9I6M3 237 SLQRAIQLGEp--lLAERAMHFWDLSQRCADIAWELADAL------GADV----ERCYTAGLLHRLGDLALLRTLQDWCD 304 Pseudomonas aeruginosa
Q88AT3 239 AKKRMAVLTDd--aLLAQAHEFWTMSQRTADYARILGGML------ELDV----ERCFCAGLLQSLGDLAVLGCLQEWLL 306 Pseudomonas syringae ...
Q88RB8 235 TLKRSARLSDp--lLAEHATRYWDLSLHTAEYGRTLARML------ELDE----GRCYCAGLLHCLGDLAVLRCLQEWRL 302 Pseudomonas putida KT...
Q5E6F6 116 AIEQLKYSSDlnseCNALLRKSAAKSREFAAVMTMVCEEIlkestdSSHDyLepEKALLSGLLADIGLFCLVNKYYNYLE 195 Aliivibrio fischeri E...
Q2SA21 236 TLREIFRSKNa--mLQKRMTKLWRHSSDVGAISFVLARMT------PGIK-P--EQALLAGILHDIGVVPVIMYAEEHPA 304 Hahella chejuensis KC...
Q3J8D7 108 VMEQIFQATSe--sLDWRMRKLWEQSTQIATIAYVLAGQK------NKLK-P--DEALLAGLIHQVGLLPILLRAEDMPE 176 Nitrosococcus oceani ...
3HC1_A 169 QVVTLVDEEKI-TFGQAEERLFGTSHCEVGFALAKRWSLNEFICDTILYHHDI 220 Geobacter sulfurreducens
Q47F47 158 MVRSAVSCGTE-GINDIERRYFGVDHCHIGRLLATHWGLPPAVVDAIYFHHDP 209 Dechloromonas aromatica RCB
Q2S8R9 341 LICRYSEANRHvDSENCEQYLLGITREQMGGKLMEMWNMPEEVCMALRYQKNP 393 Hahella chejuensis KCTC 2396
Q2SKE1 162 ETLDVAGAEGLqPELDLLLDIVEELHLDAARLALEHWRMPELIIDAVTHQDNY 214 Hahella chejuensis KCTC 2396
Q9I6M3 305 GGGA--------LDEARLDELLGRFGASFGSALRARWRLPLELRRLIAAAYQF 349 Pseudomonas aeruginosa
Q88AT3 307 AGGV--------LNEEVIKQSLEQYSAAFGSALRTRWRLPLELRELIAAVYQy 351 Pseudomonas syringae pv. tomato
Q88RB8 303 AGGD--------LDERNVQQSLEEFAAAFGSALRTRWRLPLALRELIAAIYql 347 Pseudomonas putida KT2440
Q5E6F6 196 EGNY--------LDLDVALHIFEKECNPISYHVLNHWQFDEDFLSIATNKQIS 240 Aliivibrio fischeri ES114
Q2SA21 305 LR----------THEDMLESLIMELRQEIGCALLESWEFPDAFVAAARHAEDY 347 Hahella chejuensis KCTC 2396
Q3J8D7 177 LL----------ENEAALDEIMTQLSSTLGKAILESWRFPPELVAVTAEHNDL 219 Nitrosococcus oceani ATCC 19707
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap