6CFZ


Conserved Protein Domain Family
DASH_Ask1

?
pfam08655: DASH_Ask1 
DASH complex subunit Ask1
The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis. In Saccharomyces cerevisiae DASH forms both rings and spiral structures on microtubules in vitro. Components of the DASH complex, including Dam1, Duo1, Spc34, Dad1 and Ask1, are essential and connect the centromere to the plus end of spindle microtubules.
Statistics
?
PSSM-Id: 400817
View PSSM: pfam08655
Aligned: 43 rows
Threshold Bit Score: 87.5725
Threshold Setting Gi: 598071909
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CFZ_A         8 EKLEQQITLTLQEIDSNFAKAHRIVTTSILPLVEQYGEHSRAVWEATKFWKQFFEASANVSLS 70 
ESW99766      23 SKIEQEITLTLQEIDKNLSVSNSIINESVIPRLAKFRHSSSKIWSNVEFWKTFFENSANVEIT 85  Ogataea parapolymorpha DL-1
XP_011276027  39 ERIEQEITLTLQSIDKNFAKSHRIINEKLIPIITKYHQNSIKIDQSVGFWKNFLQFSANSELK 101 Wickerhamomyces ciferrii
EEQ38949      25 ERLEQASTLLLQEIDHNLSRANAIIGDSIFPVLKKYAAATAQASSHVGFWKHFLEEAADVEIS 87  Clavispora lusitaniae ATCC 42720
XP_001482207  33 EKLEQEITLTLQEIDKNLSKANAVISEKMFPILAKYAQSSQKVWNNANFWKYFLEQAADVELT 95  Meyerozyma guilliermondii ATCC 6260
CCE86472      39 ERLEQEITLVLQEIDKNISKANAVINDKVFPVLRKHAASSTSVWNNVNFWKYFLEQSANVELT 101 Millerozyma farinosa CBS 7064
XP_007376783  32 NRLDWETSALLREIDRKLVIAIDNVNDKLMPAIARYGVECEEISKFGEMWKLFFARAAKVELQ 94  Spathaspora passalidarum NRRL Y-...
EMG48264      31 EQLDQDTTLVLQQIDRNLSRANTIINNKIKPMLQEYGIQSSKVWENAGFWKHFFEQSANVELD 93  Candida maltosa Xu316
XP_001524390  29 EQLDQDTTIVLQDIDRKLSRANAILNDLIKPTISEYMKESSKIKQSTGFWKKFFELSANVVLD 91  Lodderomyces elongisporus NRRL Y...
CCE44336      30 EQLDQDTTLVLQDIDKNISRANAIINDKLKPVIQEYGVESWKVWHNSGFWKKFFEQSANVVLN 92  Candida parapsilosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap