Conserved Protein Domain Family
DASH_Dam1

?
pfam08653: DASH_Dam1 
DASH complex subunit Dam1
The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis. In Saccharomyces cerevisiae DASH forms both rings and spiral structures on microtubules in vitro. Components of the DASH complex, including Dam1, Duo1, Spc34, Dad1 and Ask1, are essential and connect the centromere to the plus end of spindle microtubules.
Statistics
?
PSSM-Id: 400815
View PSSM: pfam08653
Aligned: 44 rows
Threshold Bit Score: 72.1926
Threshold Setting Gi: 212000525
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6BWK6        54 NTEKFESLSDALEELDVNMTNLQSIHEAISDgFNESFASFLYGLSITMWCVDFPGCP 110 Debaryomyces hansenii CBS767
EIE75928      32 LGPALEQLNKSIRNVSDKYEKLNDLDGALID-FNRSFGSFLFGLQANNETIHWkhsp 87  Rhizopus delemar RA 99-880
EKC97540      34 LAPALQDLADEVAALSTNTQRISALHDALGQ-FNEGFAAYLYALKMNAFCVEWPQAP 89  Trichosporon asahii var. asahii CBS 8904
EIM19811      41 LTPALSDLSDELDGILSSTHQMVELDKALAD-FNHGFGSLLWALKLNAYCVNWPEAP 96  Wallemia mellicola CBS 633.66
ELU43210      36 LEPAFAEFADEAAAMHRNIERMGDLYETLET-FNESFSSFLYALNMNAYTVEWPQAP 91  Rhizoctonia solani AG-1 IA
EMD37276      39 LEPAMSELVDEAESLNTNVSGLKNLGDALTT-FNESFASLLYVMNMNALTTDWPQAP 94  Gelatoporia subvermispora B
ESK96200      45 LGPAMSEFTDEIDTLQANVEGMKRLSDSLGT-FNESFASWLYIMDMNALTTDWPQAP 100 Moniliophthora roreri MCA 2997
XP_007332065  39 LEPALAEFVDETEALQSNVEGLVNLSDSLAT-FNESFASWLYVMNMNALTTDWPQTP 94  Agaricus bisporus var. burnettii JB137-S8
KDE04627      55 LAPVFAELADSLSDLTGNLRELDKSNDHLDG-FNTAFASYLYGLRITAYTADFNEAP 110 Microbotryum lychnidis-dioicae p1A1 La...
XP_007406336  56 ISPLFSDLSDSIQDLHTNLIRLDQVCENLNG-FNQSFSSYLYGLRMIYYTTDFDEAP 111 Melampsora larici-populina 98AG31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap