6CFZ


Conserved Protein Domain Family
DASH_Dad4

?
pfam08650: DASH_Dad4 
DASH complex subunit Dad4
The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis. In Saccharomyces cerevisiae DASH forms both rings and spiral structures on microtubules in vitro.
Statistics
?
PSSM-Id: 400812
View PSSM: pfam08650
Aligned: 41 rows
Threshold Bit Score: 76.8879
Threshold Setting Gi: 599402047
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CFZ_E        1 MESPHEHQQNLLLSRIITNVEKLNEAIMVMNKTLQEINIQNMNIELVAQMFKNYQSNVLFHLEATDNLKDP 71 
XP_003685638  6 MNNPYEQEQINILDRIIKNIERLNQKCHYFEYNFNRYKSKNKNLEIMGKLSENYNNNLQFNLEASGKRNGP 76  Tetrapisispora phaffii CB...
EDO14827      5 MNNPYEQVQINILQRIVKNVERLNQSVTTLNQTLEDINRKNKNLEIMGQICENYHNNIQFNLEASGNRKPP 75  Vanderwaltozyma polyspora...
CCE92516      1 MENPYEQVQLNILSRIIGNIDRLNQSVATLNQELENVNRRNRNLEIMGQICENYHNSTQFNLKATGSQKPP 71  Torulaspora delbrueckii
XP_002556503  1 MENPYEQVHQNILSRIINNVERLNESVVTLNQELQHINARNSNLEIMGQMCENYHKSVQFNMSATGHKQSP 71  Lachancea thermotolerans ...
Q6CSY9        1 MENPYEKVQSNILARIIGNVERLNQSVVILNQELRRVNTKNKNLELMSQMCENYRESVDFQLQATSKKQDP 71  Kluyveromyces lactis NRRL...
XP_003648281  7 MENPHEKVQVNILARIIGNVERLNQSVSTLNQEMQRINNRNKNLEMMGTMCENYGKAIEFNLKTTGNKRHP 77  Eremothecium cymbalariae ...
Q74Z51        1 MENPHEKVQVGILARIVGNVERLNQSVATLNQELERINTRNRNLELMGQMCEHYGRATAFNLKTTGNRQGP 71  Eremothecium gossypii ATC...
Q6FRP0        2 vENPYEEVQVNVLSRIIANVEKLNQSVRTLNQELENVNKRNKNLEVMGQICENYHRSVQFNLEATGNKKPP 72  [Candida] glabrata CBS 138
P69851        1 MENPHEQVQANILSRIIGNVKRLNESVAILNQELVTINNRNKNLEIMGAICDNYHSSVQFNLEATNNKKPP 71  Saccharomyces cerevisiae ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap