Conserved Protein Domain Family
BRE1

?
pfam08647: BRE1 
BRE1 E3 ubiquitin ligase
BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions.
Statistics
?
PSSM-Id: 400809
View PSSM: pfam08647
Aligned: 117 rows
Threshold Bit Score: 47.1849
Threshold Setting Gi: 255082780
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4DZS2        517 LQTELVNCKNNANEVNEAILELQAEATVLMQKRERLLANIANEKKEIISLENKANAMHIEMKKVNTQLSKNSEDQKNIAN 596  Trypanosoma c...
1_pfamImport    1 RQRTLVGLSQEIDANSKNMLKLQIEFTSKQELKMCLESKIKVEHREEMELDKNVKILKRDLLKLNALLSKNGELSQELEQ 80  
XP_013128473  608 QQGILMGLTQTIEANSKELLKLQTEYTGWQQTKLYFESQIESEHREEAELEKSSKMLKRDQLKLNMLLSRKGQLSQALQQ 687  Nile tilapia
XP_007234483  606 QQGELVKLSQERQAQNSAVLTLHTQLTILQQKKIKIESKVKQEQRGLAELERFSKSLRLDMQKLQSLVNQNSQLSQELQQ 685  Mexican tetra
Q56A40        576 QQGELVRFTQEKQAHSSSVQILQTQLTILQQGKIRRESEMEQDQSELADLDKQIKVLMADMVKLNSLLNKNSDLNHALQQ 655  zebrafish
XP_015212264  619 QEGELVRLSRERQAQATALQTFRRQLTILQQRKVRKESEIHQERQEQGELERHMKSLAADMLKLNTLLSQNSSMKEVLQQ 698  spotted gar
XP_011674121  740 QQGELVKMTQDKDNQQMEVDTMKKALTILHQKKMRIEGEIEGQLYDRKMVDKSIQNMQNDMLKLNQLLTREGKIRQDLHQ 819  purple sea ur...
XP_019864319  544 QQNELVKKTAEIDELVKMTDDLQKKELILSQKKIRLDDELTGEERSYVDVKKSIETLQKDMVRLNGLITGKKGEQHKLEQ 623  Amphimedon qu...
XP_004031118  460 KQTFLVMQNNRYNKLEEEVSQLKTKQTIMEQKKMRLNQNYRSYEKEIRDIQNALKNLRNDMNKLNDALHRNKEKQAKLDN 539  Ichthyophthir...
XP_009860134  617 qQHELVQLSKEREQQNVDVDKLKKQHTILTQKKLRIEGEIDQQIQEQNEIERSVRNMQNAMVKXNTLLSKEKGIQETLEQ 696  vase tunicate
Q4DZS2        597 eaflLENDLIRRLQEKKRE 615  Trypanosoma cruzi
1_pfamImport   81 khasMESDFLHRLKEAERE 99  
XP_013128473  688 enavMETDFIHRLKDAERE 706  Nile tilapia
XP_007234483  686 slilTEKSFIHELKDAERE 704  Mexican tetra
Q56A40        656 ssnlMETEFRQRLKEAEKD 674  zebrafish
XP_015212264  699 gnslMETEFLHKLKDAERQ 717  spotted gar
XP_011674121  820 dnalIENDFVLSLREAERE 838  purple sea urchin
XP_019864319  624 sntlLEKDFISALKEAELE 642  Amphimedon queenslandica
XP_004031118  540 qnfnINSEFEQKLKEFEKE 558  Ichthyophthirius multifiliis
XP_009860134  697 gnilTENEFIQELKEAELA 715  vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap