Conserved Protein Domain Family
ox_reductase_C

?
pfam08635: ox_reductase_C 
Putative oxidoreductase C terminal
This is the C terminal of a family of putative oxidoreductases.
Statistics
?
PSSM-Id: 117208
View PSSM: pfam08635
Aligned: 6 rows
Threshold Bit Score: 279.381
Threshold Setting Gi: 380865443
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5K7F9       231 RYSAAVQKMKQILKENNLEVMMTSARYVMAYEHSAKIAWWTKSVDCGPIVEQATHFCDLSRYFAGEVDLDTVMAHSIEWY 310 Cryptococcus ne...
O14082       190 RYLKTVQKAKEIIKEKNLKVVSTVAKYNSAYIHNSKKFWWIMSESGGPVVEQGTHFCDLSRYFGGDVEIDSIKVNRVEWD 269 Schizosaccharom...
Q09745       169 RYLKIVQAAKKYVADNNLNIACTIARYNSAYEHNNKLFWWYMSKSGGPVVEQATHFCDLSIYFGGDVDTSTVKVNRVNWY 248 Schizosaccharom...
XP_011387192 241 RYLKVVQKMKQILDENNLKVMATNARYVMAYEHTNKPDWWDKSISCGPIVEQATHFCDLSRYFGGEVDLATVSAHSLEWF 320 Ustilago maydis...
Q5KKC8       218 RYLNAVREMKKIIDDNNLTVMATNARYVTAYELAIKTDWWNKSIMQGPIIEQGTHICDLSRYFGGDVNIETICAHALEAH 297 Cryptococcus ne...
Q5KM75       252 RYLQCVQKMKQIIHENNLTVMATNARYSCAYEAIAKPAWWNKAIDMGPVIEQGTHFCDLSRYFGGDVDMNSIASRSVEWY 331 Cryptococcus ne...
Q5K7F9       311 EKPGQLTKIPFDESAlVPEDDRIPRFTSATWKYKSGAIGHLEHGVSLQGTQFSTEITVFADGY 373 Cryptococcus neoformans
O14082       270 DPSGKLNAMPVDEKT-IPPEERIPRFTAASWKYKDGGVGAFTHNITLQGAKYDTCIEVQADGY 331 Schizosaccharomyces pombe 972h-
Q09745       249 DPCGKLAKVPVDEES-IPKEERIPRFTAASWKYKSGAVGILAHSIILQGTNYDTCLELQADGH 310 Schizosaccharomyces pombe 972h-
XP_011387192 321 EPAGQLSKIPIDESK-IAEDQRIPRITCANWKYESGAVGSLTHAVSLQGFNYSTELDVLADGY 382 Ustilago maydis 521
Q5KKC8       298 EKPGRLSKLNFDESV-IPDNLRIPRATSASWKYESGAVGTMLHATALHGKDYAIELEVYADGF 359 Cryptococcus neoformans
Q5KM75       332 EEPGKLSKIPIDESK-IDEDLRVPRLTSAIWKYENGAVGSFQHAVALQGTAYSCELEVWADGY 393 Cryptococcus neoformans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap