Conserved Protein Domain Family
Zds_C

?
pfam08632: Zds_C 
Activator of mitotic machinery Cdc14 phosphatase activation C-term
This region of the Zds1 protein is critical for sporulation and has also been shown to suppress the calcium sensitivity of Zds1 deletions. The C-terminal motif is common to both Zds1 and Zds2 proteins, both of which are putative interactors of Cdc55 and are required for the completion of mitotic exit and cytokinesis. They both contribute to timely Cdc14 activation during mitotic exit and are required downstream of separase to facilitate nucleolar Cdc14 release.
Statistics
?
PSSM-Id: 370018
View PSSM: pfam08632
Aligned: 11 rows
Threshold Bit Score: 102.118
Threshold Setting Gi: 154270448
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6C1W8       1296 MVMYYHRFPLHIERAIYRLSHLKLANPRRPLVQQVLLSNFMYAYLDLIN 1344 Yarrowia lipolytica
CAZ83295      382 QTYYYTRFPIHIERAIYRLSHLKLANPRRPLQQQVLLSNFMYSYLAKVQ 430  Perigord truffle
O14100        812 KDYYWSRFPICTERAIYRLSHIKLSNAHRPLFQQVLLSNFMYSYLDLIs 860  Schizosaccharomyces pombe 972h-
XP_001536079  690 IDYNWTRFPISKEREIYRYAHWKLAEPKRALHSQVLLSNFMYSYLAKVQ 738  Histoplasma capsulatum NAm1
ESA42265      711 VDYSWTRFPIIEERAIYRMAHIKLANPRRPLHSQVLLSNFMYSYLAKVQ 759  Neurospora crassa OR74A
XP_001875213  555 VTNSFARYPLHVERAIYRLSHIKLANPRRPLYEQVLISNLMFWYLGVIN 603  Laccaria bicolor S238N-H82
XP_009267977 1017 aNMFDYRYPIQIERAIYRLSHLKLANPRRSLYEQVLISNFMFWYLSIVN 1065 Wallemia ichthyophaga EXF-994
XP_011272839  887 VVMLDYRFPIHVERALYRLSHLKLANPRRPLRQQVLLSNFMYSYLNLVN 935  Wickerhamomyces ciferrii
EEQ36551     1211 LVMIDHRFPVHVERAIYRLSHLKLANPKRSLREQVLLSNFMYAYLNLVD 1259 Clavispora lusitaniae ATCC 42720
CCF56682      755 VIMYDCRLATNVERAIYRLSHLKLGNRKRPLREQVLVSNFMYAYLNLVN 803  Kazachstania africana CBS 2517
Q75FB6        935 VIMFDHRLPIYVERAIYRLSHLKLSDPKRELRQQVLLSNFMYSYLNLVN 983  Eremothecium gossypii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap