6UKJ


Conserved Protein Domain Family
CRT-like

?
pfam08627: CRT-like 
CRT-like, chloroquine-resistance transporter-like
This region is found in proteins related to Plasmodium falciparum chloroquine resistance transporter (CRT).
Statistics
?
PSSM-Id: 400793
View PSSM: pfam08627
Aligned: 11 rows
Threshold Bit Score: 393.634
Threshold Setting Gi: 209882568
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6UKJ_A        64 IYILSIIYLSVSVMNTIFAKRTLNKIGNYSFVTSETHNFICMIMFFIV--YSLFGNKKgNSKERHRSFNLQFFAISMLDA 141
Q9GSB0        52 ILIYVVLYVTSGVINSVLLKKVMNKFTNYAFFLSQLTNFGYVPIFGAVtaYKIFFTKD-IPQETRDFPTRKFAIMGALDA 130 Dictyostelium d...
Q55C66        55 ILIYVLLYIISGVINVVLLKKLMIKFVNYGFFLSQITNYGYLPIFLVAmwYKMYCTSD-VPKETRNFPQYKFVIMGLLDA 133 Dictyostelium d...
Q550A6        60 VLVYVVLYILSGVINSLLLKKVMNVFTNYGFFLNQLTNYGYVPIFGAIvlYKILFTND-IPKDTRSFPQWKFVIMGALDA 138 Dictyostelium d...
EFA83226      52 VLIYSVCYVISGVINSILLKLTMNSFQNYGFFLNQLTNYGFIPIFGAVvaYKIMFTND-IPQETRDFPKYKFLIMGALDA 130 Heterostelium a...
RAW30659      13 LLVSFVAMVFVGLGNKIFQKLQTIPMHNYPTFLNLLTTFVYIPISFAYilPMIQYGSA-ITWDQRSIPKRKFAVMGGLDS 91  Phytophthora ca...
CBJ27236      57 LLLSFTAMVFVSLANKVFQKLETIPMYNYPNFLNLFTTFVYIPFSFAYiiPMMRYGDT-ITPEQTSVPKRVFAVMGALDG 135 Ectocarpus sili...
XP_002142720  52 LIFCMLGLLLSSVVNSVYFKKMTNAMPNHVWFLTQLISGLYVPFFGIIv-lILYLKNN-ISDETLKIPLRKFWIMGFLDS 129 Cryptosporidium...
Q8IBZ9        61 IYILSIIYLSVCVMNKIFAKRTLNKIGNYSFVTSETHNFICMIMFFIv--YSLFGNKKgNSKERHRSFNLQFFAISMLDA 138 Plasmodium falc...
EGG18312      42 IIIYTLCYIVSGVINSILLKLTMNSFQNYGFFLNQLTNYGYIPIFGAVvaYKLYFTND-IPEETKLFPKYKFLIMGALDA 120 Cavenderia fasc...
XP_003284187  55 ILLYVVLYISAGVVNSILLKKVMNVFSNYAFFLNQLTNYGYVPIFFSVvlFKFIFTND-IPKETRAFPTYKFAIMGALDA 133 Dictyostelium p...
6UKJ_A       142 CSVILAFIGLTRTTGNIQSFVLQLSIPINMFFCFLILRYRYHLYNYLGAVIIVVTIA-LVEMKLSF-----ETQE--EN- 212
Q9GSB0       131 ITGFFVVIGGVSTSGPLQQLLNQAIIPFTMIASFIFLKERYSLIQLGGALVIIGGVVtSLIPSLLG-----GSSG--GN- 202 Dictyostelium d...
Q55C66       134 INGFFVVIGGVSTSGPLQQLLNQAIIPFTMIASFIFLRERYSLFQLGGAAVILGGVIvSLIPSLVG-----GSSG--GN- 205 Dictyostelium d...
Q550A6       139 VTGYFVVIGGIKTTGPLQQLLNQSVIPFTMLLSFIFLKERYSLIQLGGALIIIGGVVvSLIPSLTG-----GNTS--GN- 210 Dictyostelium d...
EFA83226     131 VTGYFVVIGGISTSGPLQQLLNQAIIPFTMLSSLVFLKMRYSWIQVTGALVIIAGVVvSLIPSLTG-----KSDA--NN- 202 Heterostelium a...
RAW30659      92 IAGILQVFAATYLGGSLIILLGQAAIPISMLISSLLLKAKYSGYQYVGAVVVTLGLLiVLGSGNSS-----SSTG--TNp 164 Phytophthora ca...
CBJ27236     136 VSGIMQIFASTYLGGSLIILLTQAAIPISMVTSKRLTGARYSVSQYTGATVVAAGIViAIGPSLAV-----GSSSggGQ- 209 Ectocarpus sili...
XP_002142720 130 FGSILTLLASVHTSGVMQVILGQFCTPITLIMLTIFCKDKFHIMQYLGAFIMIIGIFiVKSAVILGfrdisESDK--SN- 206 Cryptosporidium...
Q8IBZ9       139 CSVILAFIGLTRTTGNIQSFVLQLSIPINMFFCFLILRYRYHLYNYLGAVIIVVTIA-LVEMKLSF-----ETQE--EN- 209 Plasmodium falc...
EGG18312     121 VTGYFVVIGGVRTSGPLQQLLNQAIIPFTMLASLIFLKERYSLIQVGGAAVILSGVVvSLIPSLTG-----PPDP--TN- 192 Cavenderia fasc...
XP_003284187 134 VSGYFVVIGGISTSGPLQQLLNQAIIPFTMLASFLILKERYSLVQMGGAAVIVGGVIvSLIPSLVG-----GGNS--GN- 205 Dictyostelium p...
6UKJ_A       213 --SIIFNLVLISSLIPVCFSNMTREIVFKKY-KIDILRLNAMVSFFQLFTSC-LILPVYTLpFLKQLHLPYNEIWTNIKN 288
Q9GSB0       203 --KPFWNFFYLLSVIPGALSNVYKDIGFQAVaDMDVWYLQYWDSLYQSIFGL-FLFPVNNW-LPPPATVKFEQILPFMKE 278 Dictyostelium d...
Q55C66       206 --ILFYNFFYLISVIPGALSNVYKDIAFQSI-DMDVWYLQFWDCLYQSLFGS-ILFPVNNW-LPPPATIKFTEIIPSMRD 280 Dictyostelium d...
Q550A6       211 --MLFYNFFYLISMIPYAFSNVYKAIGFSTVeDMDVWYLQYFDALYQSLVGT-VLFPINNW-LPPPSDMKFNQVIPQLKA 286 Dictyostelium d...
EFA83226     203 --KVFWNLFYLISMIPFALSNIYKDIGFQSVqDMDVWYLQFYDSLFQGIVGT-FLFPINNW-LPPPGGIKFKDIIPSLRD 278 Heterostelium a...
RAW30659     165 hlIVLWSVVMIFSCVPMCLSSVYKEKTLGEA-ELDAVYLNGWIAVFQFLFSIpLTFPAAMV-GDHPV--TPRELPENMYD 240 Phytophthora ca...
CBJ27236     210 --ELVWSMVLVASCLPMALSSVYKEMALGES-ELDPIYLNGWVAVFQFLVCI-P-LAVPAA-LAGDPAISPLELPKNLWD 283 Ectocarpus sili...
XP_002142720 207 --YLVFNILFIISCIPASASSVYKDMTFRETsSLNEHYLQFNVALAQVIIGF-FLAPINSIpILGPLKIEITEIPSLLGQ 283 Cryptosporidium...
Q8IBZ9       210 --SIIFNLVLISALIPVCFSNMTREIVFKKY-KIDILRLNAMVSFFQLFTSC-LILPVYTLpFLKQLHLPYNEIWTNIKN 285 Plasmodium falc...
EGG18312     193 --SVFWNFFYLISIIPFAGSNVYKDIGFQAVaDMDVWYLQFWDAFFQSIIGT-FLFPINAI-LPGDAKIPFNQVLPAMKN 268 Cavenderia fasc...
XP_003284187 206 --KPFWNVFYLISVVPGALSNVYKDIGFKAVeDMDVWYLQFWDAFYQSLIGT-VLFPINNW-LPPPATIHFRDIIPSLKN 281 Dictyostelium p...
6UKJ_A       289 GFACLfLGRNTVVE---------------NCG-----LGMA--KLCDDCD-GAWKTFALFSFFDICDNLITSYIIDKFST 345
Q9GSB0       279 GAECL-AGINSIIPsyingt---ssftatSCT-----YAPDatITCDDCH-NAWIVIILYMTINIIYNIFILLVLKHAGA 348 Dictyostelium d...
Q55C66       281 GALCL-GGKNTILPifngtt---stlafgSCG-----INDN--FVCDDCH-NTWIIVLIYMTVNIAYNIFILLVLKHAGA 348 Dictyostelium d...
Q550A6       287 GGKCL-GGINTLIEqynstt---gellptSCN-----YGDN--LGCDNCH-GAWVVVLIYMAVNVLYNVFILLVLKHAGA 354 Dictyostelium d...
EFA83226     279 GAECL-AGTNTITMassnnt--------------cdlpttD--FPCDNCH-NAYIIIIIYMTINIVYNVFILLVIKHAGA 340 Heterostelium a...
RAW30659     241 GLMCY-LGQNTINDg----------------------------AHKDDCE-KATVYVTAYLLFNVAYNLLIILILKFGSA 290 Phytophthora ca...
CBJ27236     284 GWMCY-LGYNSVMIg------------------------E----HPDNCWpDSPLYVTLYLMVNITYNILITLILKYGGA 334 Ectocarpus sili...
XP_002142720 284 GLRCL-FLKQNIvt--------------tNCG-----NDGQ--RSCDMCE-LVQLPVLIYFIANIICNIFSIMVIKHGSA 340 Cryptosporidium...
Q8IBZ9       286 GFACLfLGRNTVVE---------------NCG-----LGMA--KLCDDCD-GAWKTFALFSFFNICDNLITSYIIDKFST 342 Plasmodium falc...
EGG18312     269 GALCL-AGHDIIVD---------------NCG-----TDLQ--TTCDNCH-HAYIIILCYMTINVIYNIFILLVIKHAGA 324 Cavenderia fasc...
XP_003284187 282 GTLCL-GGHDSILPiwnttsgftnttipgSCTpyplqYPDL--TPCDDCH-HAYILIILYMSINIIYNVLILLVIKHAGA 357 Dictyostelium p...
6UKJ_A       346 MTYTIVSCIQGPALAIAYYFKFLAG-DVVREPRLLDFVTLFGYLFGSIIY 394
Q9GSB0       349 TVYSIANTLRLPLTNIVFSIHFIMG-SAVSPFSGLSVAGLVIILVGLGGY 397 Dictyostelium discoideum
Q55C66       349 TVYSIANTVILPLTNIFFSIHFIMG-AATTPFSALSVAGLLLILFGLGGY 397 Dictyostelium discoideum
Q550A6       355 TVFSIANTLRLPLTNIAFSFKFIMG-SDSNPFSGLSVAGLCIILLGLGGY 403 Dictyostelium discoideum
EFA83226     341 TVYSIANTLRLPLTNIVFSLKFIVPvSIYQAFSGLSVAGLIIILLGLVGY 390 Heterostelium album PN500
RAW30659     291 NILWLAMTIMVPLGNVAFTFPFM---PEHQPLHAKDIAGLLFIMLGLFVY 337 Phytophthora cactorum
CBJ27236     335 NVLFLAMTICVPLGNVIFALPFVPG-H--QPLHATDILGLIFVMTGLVLY 381 Ectocarpus siliculosus
XP_002142720 341 ATGFIVSTMRLPLTTFVFFSSTLVG-KEATTPHIEDFIGIFILVCGLILY 389 Cryptosporidium muris RN66
Q8IBZ9       343 MTYTIVSCIQGPAIAIAYYFKFLAG-DVVREPRLLDFVTLFGYLFGSIIY 391 Plasmodium falciparum 3D7
EGG18312     325 TVYSIANTLRLPLTNIVFSLHFIMG-AAVTPFSGLSVAGLIIILLGLVGY 373 Cavenderia fasciculata
XP_003284187 358 TVFSIANTLRLPLTNIVFSLHFIMG-INTTAFSGLSIAGLIIILLGLGGY 406 Dictyostelium purpureum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap