Conserved Protein Domain Family
RPAP1_N

?
pfam08621: RPAP1_N 
RPAP1-like, N-terminal
Inhibition of RPAP1 synthesis in Saccharomyces cerevisiae results in changes in global gene expression that are similar to those caused by the loss of the RNAPII subunit Rpb11. This entry represents the N-terminal region of RPAP-1 that is conserved from yeast to humans.
Statistics
?
PSSM-Id: 400787
View PSSM: pfam08621
Aligned: 122 rows
Threshold Bit Score: 40.5784
Threshold Setting Gi: 527299435
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELR06957      108 HIDLENQKRIAAMSPEDIEQERNELLSALDPNLVRMLMSRAEKK 151  Pseudogymnoascus destructans 20631-21
EMD39597      104 QIDEENRRRIENMTEEEREQERQEILERFGPNVTETLRRAREAR 147  Gelatoporia subvermispora B
EPT00236       96 QIEEENQRRVEAMTEEEREQERREILEKFGPDVSEILRKAREAR 139  Fomitopsis pinicola FP-58527 SS1
EKD02332      104 QVEAENRARVANMSPAEREQEAEELKERFGPGLADLMRKRRDAR 147  Trichosporon asahii var. asahii CBS 8904
Q5KFJ8         89 QVQGDNSKRVQNMSQQEREQEIEELRERLGDKTLDLLRKRAEAR 132  Cryptococcus neoformans
Q5KFJ8        166 DVSEENTRRVDLMSFEEREQETEELRERFGDKIMEALRRRAEVK 209  Cryptococcus neoformans
CCF54253      362 KVSRENDQKLRQMSVAEVSEEIRSLESLFGKDVLDALRNRKGAG 405  Ustilago hordei
CCD71950      164 dFQAENEKYLKSLDFEKIQEMKLEITERFDPKLLEFLKNRGNKA 207  Caenorhabditis elegans
2_pfamImport    1 -FQAENENYLKSLDTQKIAELRQEIQERFDPKLVEFLANRGKNN 43  
XP_002647126  179 dFRAENEQYLKSLDPQKIDNLMAEIKERFDPQILEFLKNRGAKK 222  Caenorhabditis briggsae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap