5NPV


Conserved Protein Domain Family
ATG16

?
pfam08614: ATG16 
Autophagy protein 16 (ATG16)
Autophagy is a ubiquitous intracellular degradation system for eukaryotic cells. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. ATG16 (also known as Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate in the yeast autophagy pathway.
Statistics
?
PSSM-Id: 400781
View PSSM: pfam08614
Aligned: 107 rows
Threshold Bit Score: 101.161
Threshold Setting Gi: 255078428
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5NPV_B        25 AFEEIil-qYNKLLEKSDLHSVLAQKLQAEKHDVPNRH--EISPGHD----------GT-------------WNDNQLQE 78 
CBQ69919      26 QHDAVfhhsDRKLAEQTRLLKQRNRALLNAAAVAPS--------ASAagtsssvatgSPtpssssstaaanpVQLAYITS 97  Sporisorium rei...
GAC97715      26 QYDAVcl-hYRKLADQTRLLKQRNRALLNAAAAAPS--------ASTvgast-saadSPassa-----avnpVQLAYITS 90  Pseudozyma hube...
GAC75551      55 QHDAMfq-qYRKLAEQTRMLKQRNRALLNAAAVAPSPS--SASASSPagatsgaaspSPsvtp-----aatsVQLAYITS 126 Moesziomyces an...
XP_006958086  22 INESYad-nYKRLLQQYHIIKEQNDTLIKASEEPSTdtnlss-------------------------tngnkLQAALVHS 75  Wallemia mellic...
CCA70170      20 SHGPVid-qYRRLAQHTRLLNARNQTLLRATGAARPNP--NSSTVMVged--------------------npVRTAYIQS 76  Serendipita ind...
XP_001828915  23 VFAGIie-qYRRLAQQTKLLKERNASLLRAVNTVKGNP--NASTVLLastg-----------------eenpVQAAYISS 82  Coprinopsis cin...
EMD41677      23 AYASIie-qYRRLAQQTKLLKERNASLLRAMGTARANP--SSSTVFVpgsa-----------------eenpVRAAYIAS 82  Gelatoporia sub...
EPT04166      23 SYASIie-qYRRLAQQTKILKERNASLLRAMGSARANPnpSSSTVYVpgsg-----------------ednpIRAAYITS 84  Fomitopsis pini...
CCF50309      26 QHDLIcl-qYRKLSEQTRLLKQRNRALLNAAAVAPSFP--SSVPGSTtttsssststSPtpsts----panpVQVAYITS 98  Ustilago hordei
5NPV_B        79 MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKD 158
CBQ69919      98 LEQQLSSLRDEVATLYKTQGQNAQRLLLMSESHREKEEEARRQSEALAKLQLDHEKLKRQADDLGHAVGEKDKGIQILQD 177 Sporisorium rei...
GAC97715      91 LEQQLSTLRDEVALLYKNQGQNAQRLLLMSESHRDKEEEARRQTETLAKLQLDHEKLRRQADDLSHAVGEKDRGIQILQD 170 Pseudozyma hube...
GAC75551     127 LEQQLASLRDEVATLYKTQGQNAQRLLLMNESHREKEDEARRQSELLAKLQIDHEKLRRQADDLTHAVGEKDRGIQILQD 206 Moesziomyces an...
XP_006958086  76 LQQQLHSTRDELTNLYKGQNQSSQRLLEMNETLRERDDNLRAIEAENLSLKASVSRLSKAREDDVEGKRERERGMEALQD 155 Wallemia mellic...
CCA70170      77 LESQVSALRDEMAASYKTQGQNAQRLLAMNETLREREDAARIDAENLRLAREEVAVLRRKVEQHAEQMAEKDRAFQDLTD 156 Serendipita ind...
XP_001828915  83 LESQISSLRDELATVYKTQSQNSQRLLSMNETLREKEELIRIEAESHRRAKEELAVVKKKVDQHNELMAEKDRTVQILHD 162 Coprinopsis cin...
EMD41677      83 LESQISSLRDELATVYKTQGQNAQRLLAMNETLREKEELSRVDSENLRKAREEIATLRRKVDQHNELMAEKDRTAQILHD 162 Gelatoporia sub...
EPT04166      85 LESQISSLRDELATVYKTQGQNAQRLLAMNETLREKEELSRVDSENLRKARDDIAALRKKVEQHNELMAEKDRTAQILHD 164 Fomitopsis pini...
CCF50309      99 LEQQLSSLRDEIATLYKTQGQNAQRLLLMSESHRTQEEEFRNQTESLAKLQLEHEKLERQAEDLTHTIGEKDRGMQILQD 178 Ustilago hordei
5NPV_B       159 EYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLN 200
CBQ69919     178 ELATLSLELSQIEARNQDLKKDNASLLQRWLDRMNEEADKMN 219 Sporisorium reilianum SRZ2
GAC97715     171 ELATLSLELSQIEARNEDLKKDNASLLQRWLDRMNEEADKMN 212 Pseudozyma hubeiensis SY62
GAC75551     207 ELATLSLEVSQIEARNQDLKKDNASLLQRWLDRMNQEADRMN 248 Moesziomyces antarcticus T-34
XP_006958086 156 EITTLRLELEQIEIRNQNLKNDNAALIQRWLDRMNQEADKMN 197 Wallemia mellicola CBS 633.66
CCA70170     157 EYNLLNLEFGQVEEQKDNLKKDNATLIQRWIDKQNSIGDVLN 198 Serendipita indica DSM 11827
XP_001828915 163 EISTLQLELGQIEERNQTLSRDNAKLLQRWLDAKQAEANRMN 204 Coprinopsis cinerea okayama7#130
EMD41677     163 EISALQLELSQIEERNQTLTKDNAKLLQRWLDAKQAEVNRMN 204 Gelatoporia subvermispora B
EPT04166     165 EINTLQLELTQIEERNSILTKDNAKLLQRWLDAKQAEVNKMN 206 Fomitopsis pinicola FP-58527 SS1
CCF50309     179 ELATLSLELSQIEARNEDLKKDNASLLQRWLDRMNEEAEKMN 220 Ustilago hordei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap