Conserved Protein Domain Family
DUF1774

?
pfam08611: DUF1774 
Fungal protein of unknown function (DUF1774)
This is a fungal family of unknown function.
Statistics
?
PSSM-Id: 400778
View PSSM: pfam08611
Aligned: 53 rows
Threshold Bit Score: 73.7805
Threshold Setting Gi: 320036031
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KLU82528             191 RIFANIFVWSILVYGGFFLAVYKDYTMGFNLSVLAAALGVAQFFRQVIALQWIFAFTIMSVLFVVSLAIAIPTWSGHNss 270 Magnapo...
XP_011274611         173 RIVANVFIWDFLLVPSFALIIYRDWAIGLSSAALQLALGLGQLFTKVFALQWIFAFIIAGLLFLFSVAVLSAELKEGDrt 252 Wickerh...
EDK42178             172 RILANVFIWNFLLVPGFFLLVFNDWATGLGFSYLLFALAIGQLENKVFALQWIFAFTIAGILLVWSVVAAIVGGIRLT-- 249 Loddero...
EMG49512             171 RILANIFIWDFLLVPGVFLLLFNDWAIGFSSAYLMFALAFGQLATKVFALQWIFAFVIAGILTVWSFIAMVAGGVRNA-- 248 Candida...
ESX00202             177 RILANVLVWEFLVVPLAILVFYQDWSIGLSTSLLMLGLGFGQLFTKVVALQWLFAFIIAAVNFVVSVVIMFGSGLRTV-- 254 Ogataea...
LoveMIT:GQ68_02410T0 179 RLLANLLIWEFLLVPAFFIVVFADYGVGFSSSYLTLSIAVGQLLTKVIGLQWIFGFVIAGTIFLLSLLVSTGVLAGKV-- 256 Komagat...
EGV60554             174 RVLANIFIWDFLIIGVVFLTLFNDYTVGFSLSYLVLGMALNQLFTKFVALQWIFGFIISGLLLVISVGTILLKPKLKD-- 251 Yamadaz...
XP_007375712         170 RILANIFIWNFLGIGSLLVYAFDDCAVGFSLSYLMFALMVGQLTIKVFALQWIFALAIAVVLFLVSSGALVNRLRGESg- 248 Spathas...
XP_002171433         173 RVFSNVMIWFIAGAYLVPIFAFYDATLAFLSSYIFFSMGVGQVMISLFTLQYVFAFLLSIILAVVGVGALFMPKRTPAs- 251 Schizos...
O94440               172 RVFSNVFIWFFAAMYLVPILGFHDWALSLVSAYLFLSIGIGQMFIHLFALQHIFAFIIAGLMTLFAALLFLLPYRQRR-- 249 Schizos...
KLU82528             271 wttRRSdqaPpQDAERAPLL 290 Magnaporthiopsis poae ATCC 64411
XP_011274611         253 --------dNsTDAENAPLV 264 Wickerhamomyces ciferrii
EDK42178             250 ------------AGENAPLL 257 Lodderomyces elongisporus NRRL YB-4239
EMG49512             249 ------------GEERAPLL 256 Candida maltosa Xu316
ESX00202             255 -----------NREEQAPLL 263 Ogataea parapolymorpha DL-1
LoveMIT:GQ68_02410T0 257 ---ANNnnvLgSDREQAPLL 273 Komagataella phaffii GS115
EGV60554             252 ---QIVvqeEsVGSATAPLL 268 Yamadazyma tenuis ATCC 10573
XP_007375712         249 -----------QPSEAAPLL 257 Spathaspora passalidarum NRRL Y-27907
XP_002171433         252 ---------PaGDVEQAPLL 262 Schizosaccharomyces japonicus yFS275
O94440               250 ---------AaLTGESAPLL 260 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap