Conserved Protein Domain Family
Mgr1

?
pfam08602: Mgr1 
Mgr1-like, i-AAA protease complex subunit
The S. cerevisiae Mgr1 protein has been shown to be required for mitochondrial viability in yeast lacking mitochondrial DNA. It is a mitochondrial inner membrane protein, which interacts with Yme1 and is a new subunit of the i-AAA protease complex.
Statistics
?
PSSM-Id: 369991
View PSSM: pfam08602
Aligned: 13 rows
Threshold Bit Score: 516.145
Threshold Setting Gi: 372463396
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003675349     1 MALYTPPDKPDs--sNGDDHPKNGSINDSNNDNDefemkrhKFYPRPSLGLKLWGPLVPASDNKNGLWTLIGVQTAMGVF 78  Naumovozyma c...
CCH58541         1 MAVYTPPNKST----DNSSKSPTDTTDDSSRDIE-------KFYIRPSLGLKMWGPLVPASDNKTGLWALVGTQTVIGIL 69  Tetrapisispor...
XP_003685903     1 MTLYTPPDKN-----QKDKGDAAKNVDSSNEPL--------KLYPRPSLGLKMWGPLVPASDNRVGLWSLVGAQTLIGLF 67  Tetrapisispor...
EDO18959         1 MALYTPPEKSDnsgqASTSTKKGNEGDDLDDSK--------RFFVRPSIGLKMWGPLVPASDNRAGLWTLIGLQTGIGVL 72  Vanderwaltozy...
CAR23819        47 MGLYSPPDGSKa--pNAPALAQKEAPDKPNDGALi------KFYPRPSLGLRFWGPLVPASDNREGLWTLVGIQTVFGLL 118 Lachancea the...
Q751V6           1 MALFTPPSE------DKDGRDRSGGGDKASGVVRt------PFHLRPSLGLALWGPLVPASDNRAGLWTLVGLQTLMGAF 68  Eremothecium ...
ybcl:Ecym_1035   1 MSLFTPPTGGKg---SSFNRVPSKDPEKPEKDIRs------QFYSRPSLGLKFWGPLVPASDNRVGLWSLVTAQTLVGLF 71  Eremothecium ...
XP_002497981     1 MALYTPPDKSsp-pkAHENEEDKGGSNREQDDIK-------KFYVRPSLGLRLWGPLVPASDNKMGLWSLIGIQTAVGTF 72  Zygosaccharom...
CCE91562         1 MALYTPPGKSPsrpqAKENENDKK--DDPKDDIS-------KFYVRPSLGLRLWGPLVPASDNKVGLWSLIGIQSAVGIF 71  Torulaspora d...
CCD22190         1 MALYTPPDNSDs--sSNDSKSYGKDNNDISDDTKkl----eKFYSRPSLGLRLWGPLVPASDNQNGLWTLITIQTGIGLF 74  Naumovozyma d...
P25573           1 MAVFTPPSGNSn---STDHTHTQDDHDKDDNDIK-------KFYIRPSLGLKLWGPLVPAPDNLPGLYTLITIQSAVGFF 70  Saccharomyces...
CCF57676         1 MAVYTPSGNNNnsgiNDNDVGSASEME--------------KFFVRPSLGLKLWGPLVPASDNRTGLWTLLTIQTVVGIG 66  Kazachstania ...
Q6FX96           1 MGIFTPPGKSDkrdaNEEKPTLLGSNSKDETDVE-------KFWVRPSLGLKLWGPLVPASDNKTGLWTLVAVQSMVGLL 73  [Candida] gla...
XP_003675349    79 CFYRFRKLGIRPFStsptasplgfi----------------knattfkqngkNTIKDIADLPSLNRFSTSHGELLVndsa 142 Naumovozyma c...
CCH58541        70 CVQRFRMLRLRPISqstst----------------------------lgfkkLSGRNIADIPSLNRFSTANGSLMT---- 117 Tetrapisispor...
XP_003685903    68 FLRRGWTIRKNVNMrnlat-----------------------------gvspAFKTDISNIPTLNRFS--NGPVATgt-- 114 Tetrapisispor...
EDO18959        73 CMIRFRQLRKLNTIsk-----------------------------------nVIKKDIAEIPSLNRFSQSHGTVYVpkpm 117 Vanderwaltozy...
CAR23819       119 CLRRSRSIGSS-----------------------------------------IVKREISKIPSLNRFSVTRGSMYVs--- 154 Lachancea the...
Q751V6          69 FVSRFRALRPK-----------------------------------------LLKRDIADFPSLNRFSKTSGDMHVg--- 104 Eremothecium ...
ybcl:Ecym_1035  72 FMCKFRNLGPK-----------------------------------------VIKRDISDFPSLNRFSTTFGGMYVt--- 107 Eremothecium ...
XP_002497981    73 CLHRIRVLRASMK---------------------------------------FVSKDIANIPSLNRFSKTHGAMVLnpv- 112 Zygosaccharom...
CCE91562        72 CMYRIRRLRGSLN---------------------------------------TVRKNIADIPSLNRFSTTQGELVMppp- 111 Torulaspora d...
CCD22190        75 FLYRYRALGKHYSK--------------------------------------SIIRDIADVPSLNRFSTTHGQIPLtnni 116 Naumovozyma d...
P25573          71 ALWRLRRLYKLPPPrriatgthsdlsf------------gelpsemivngktKIKKDIADFPTLNRFSTTHGDIVL---- 134 Saccharomyces...
CCF57676        67 CFKRFNSLRRAHQ---------------------------------------VIKTNISRLPTLNRFSKTDKIISI---- 103 Kazachstania ...
Q6FX96          74 CFYRFKSLRIIDRNgalnsvgksgirptsvlvnepklynsaftqqeavsgkpLVKKDIADFPTLNRFSTTHGDMFVntt- 152 [Candida] gla...
XP_003675349   143 kgvtpgeistaLKPGLTGS---------SMSSFSKKTSYDGKNnen---------------------------------- 179 Naumovozyma c...
CCH58541       118 -----------SSKPKIFQ---------LISQFKLKSSNSYKQ------------------------------------- 140 Tetrapisispor...
XP_003685903   115 ----------aTTKPSIFAs--------ILTRFIKRQPTGSRFgarygyq------------------------------ 146 Tetrapisispor...
EDO18959       118 memsgntaaspNSAAISNS---------GATTISNIETQNISNnnsntidtgsndsnnknnniaasnaetntnspamaas 188 Vanderwaltozy...
CAR23819       155 -----------EHGPTAFG---------STNSFSRRGSNLWGFl------------------------------------ 178 Lachancea the...
Q751V6         105 ----------pVHVFADFG---------GTHSFHRRAGESPGFf------------------------------------ 129 Eremothecium ...
ybcl:Ecym_1035 108 -----------THLFPEFG---------GTYSFHRRVGERTGFf------------------------------------ 131 Eremothecium ...
XP_002497981   113 --------nnpLKKPLNSNsrfr--------------------------------------------------------- 127 Zygosaccharom...
CCE91562       112 --------sltGSAPTTFT---------AGHGVQKASYGGTAFggassffkss--------------------------- 147 Torulaspora d...
CCD22190       117 spv--nkvstpNSKLASNTifkgktplfGISSFSKRENPKDTSssgvgeprks--------------------------- 167 Naumovozyma d...
P25573         135 ------------APPPIIP------------------------------------------------------------- 141 Saccharomyces...
CCF57676       104 -----------ESKPLQ--------------------------------------------------------------- 109 Kazachstania ...
Q6FX96         153 --------nvnRNTPSLSA---------APVVASPVLSSAGHQseimaksea---------------------------- 187 [Candida] gla...
XP_003675349   180 -----------------------------------fnYSSKFTTFKRALYIFTGALLLSQSLLETCRLEILKYDPWLEEA 224 Naumovozyma c...
CCH58541       141 -------------------------------------FKTKYQHFSKYIYLLFGSVILFQSSLETLRLTIIKYDPWCEEV 183 Tetrapisispor...
XP_003685903   147 ----------------------------------nqqswqgFRSFASLLYLFVGALVISQSTLEIMRLVLLKYDPWYDEA 192 Tetrapisispor...
EDO18959       189 ttlpintaaysslnvvsqglnnkgfqgsegkwrysssRSSRFGNFKSFMFFLAGSVVLFQSFLEAARMTLLKYDPWREEA 268 Vanderwaltozy...
CAR23819       179 -------------------------------------RSTKFIALRKSLYLVGGTLLLSQSLLEACRLQILKYDPWYEEA 221 Lachancea the...
Q751V6         130 -------------------------------------QSRRFVSLKRALYLSTGVVLLVQSALESARLTLLVYDPWEEQA 172 Eremothecium ...
ybcl:Ecym_1035 132 -------------------------------------YSKRFANIKRVIYLTTGTVLLAQSMLEASRLTLLEYDPWEEQA 174 Eremothecium ...
XP_002497981   128 ----------------------------------qlfSSPRWSTFKNVVYLLTGTLLLSQSLLEASRLTILKYDPWYEEA 173 Zygosaccharom...
CCE91562       148 ----------------------------skengksgfKFASFMTFKQVIYLLTGTLLLSQSLLEACRLTILKYDPWAEEA 199 Torulaspora d...
CCD22190       168 ----------------------------nwngndnfkYSSKFIIFKRILYGLTGAIILSQSLLETCRLKILKYDPWLEEA 219 Naumovozyma d...
P25573         142 -------------------------------------RQSRFVSVRKLLWGLFGSLLLSQSLLELTRLNFLKYDPWCDEM 184 Saccharomyces...
CCF57676       110 -------------------------------------KLSRWDTTKKFIYLFSGTVILSQSLLELCRLSLLKYDPWYEEA 152 Kazachstania ...
Q6FX96         188 -----------------------------knnwksffKSDNWLIFKKVFYLLAGSIILSQSMLEACRLTILRYDPWCEEA 238 [Candida] gla...
XP_003675349   225 KSVRDKKLFNDIIKFYHEGIDPTKVNVRDVMSGN----PVSTNIPEVKQSVALVRAQSEAENPVIKWFGPIEYKPMTFTE 300 Naumovozyma c...
CCH58541       184 KSLRNKKLFNDLIKFYHEGIDPNKVKVKDATSGN----ILSINIPEVKQSVALVRAQAESQNPIIKWFGPIQYKPMSFSD 259 Tetrapisispor...
XP_003685903   193 KSAREKKFFNDIVKYYHEGIDPTKIKVKDASSGT----ALSTNSPQVRQSVALVRAQAENESILTKWFGPVYFKPMSFND 268 Tetrapisispor...
EDO18959       269 KSVREKKFFNDIILFYHEGIDPTKIKVKDAASGN----ALSTNIPQVKQSVALVRAQAEAENPIIKWYGPLDYKPMSFND 344 Vanderwaltozy...
CAR23819       222 RSVREKQFFNNIIKYYHEGIDPTKFKVKDASNGA----VLPLSSPEVKQSVAFARATLEADSWFTSWFGPIEYKPMSFTE 297 Lachancea the...
Q751V6         173 RGVRDKQFYNDVVRYYHEGVDPARFIVKDPASGN----TLPVNVPEVKQGVALARAHTNARNIITRWLGPLDCKPLSSSE 248 Eremothecium ...
ybcl:Ecym_1035 175 KCVRDKQFFNDVVKYYHEGVDPMRFKVRDANSGT----TLSVNIPEVKQGVAVARAQANAENLVTKWLGPLDYKPLSFSD 250 Eremothecium ...
XP_002497981   174 KSVRDKKFFNDIIQFYHEGIDPTKVKVKDATNGN----VMSTNIPEVKQSVALVRAQAEAENPIIKWFGPIEYKPMSFTE 249 Zygosaccharom...
CCE91562       200 RSVRDKKFFNDIIKFYHEGIDPTKVRVKDASSGN----VMPTNIPEVKQSVALVRAQAEAENPIIKWYGPLEYKPMSFSE 275 Torulaspora d...
CCD22190       220 KCVREKKFFNDIIKYYNEGIDPTKVKVKDSMSGN----PVSTNIPEVKQSVALVRAQNEAENPIIKWFGPIEYKPMSFTE 295 Naumovozyma d...
P25573         185 KSVRDKKFFNNIVKYYHEGIDPTKIKVKDAMNGT----PLSTNIPEVKQSVALARAQVEAQNPIIKWFGPLEYKPMSFNE 260 Saccharomyces...
CCF57676       153 RCARDKKFFNDIIKYYNEGIDPTKIQVKVKRSGGddsvSVNPNVNEIKQSVAIVRAQNEASNPIIKWYGPIELEPMSFND 232 Kazachstania ...
Q6FX96         239 KTVREKKFFNNIVKFYHEGIDPTKVKVKDAVSGN----IMPTNVPEVRQSVALVRAQTEAENPIISWFGPIEYKPMTFSE 314 [Candida] gla...
XP_003675349   301 YLDRVEYHLEMFEYFLSKR-------AVNTLLWETIRP----SSIALEEVKNKNDQFKEKIHKKFlksqpslhqqhmnql 369 Naumovozyma c...
CCH58541       260 YLDQLEFHLDMLESFQKKNsv----nEASEHLRNQLAN----TDEEIQNFIKKNKENREKALKYVinssnvsfids---- 327 Tetrapisispor...
XP_003685903   269 FLDKLEYNLDIQDKIDDKKks----kLISKSIQRKLRH----TPDELHNLKVINEENRKKTLQLLdlnrgi--------- 331 Tetrapisispor...
EDO18959       345 FLDRLEFQLDMRVSLDNRRs-----tAVSKSFTSQFKH----TEEELDSLINNNEKNRQLTLEgklsppknn-------- 407 Vanderwaltozy...
CAR23819       298 YLDRLEYHLEMTDFIRNGRnn----dAASQLLGRPLSH----GTAELEELIQKNRSSRKKIGNLM--------------- 354 Lachancea the...
Q751V6         249 FLDKLEHYLDTCDFIQDMN---------NKRLFGNPAEvk-aRQKALDALIQANKENRRRIRHIL--------------- 303 Eremothecium ...
ybcl:Ecym_1035 251 FLDKLEHNLDMYDILHHTN---------SKKIIDDTKHas-eRKAELEFLTEINRKNRERIRTLL--------------- 305 Eremothecium ...
XP_002497981   250 YLDRMEYHLDIDALLHDKRtl----kENQQHLNTQITH----TEGELDSIVRHNQEVKERTKDLV--------------- 306 Zygosaccharom...
CCE91562       276 YLDKLEYHLEMIVFLQEDKka----kETAMEIMHKITY----SATEVEELGKKNVENRKKAYELV--------------- 332 Torulaspora d...
CCD22190       296 YLDRLEYHLDMFDFFQKKR-------AANALLWNSITH----TTNDLEEIIRKNEAARKKICKKFeknkpsahqkhlqdl 364 Naumovozyma d...
P25573         261 YLNRMEFHLDMFEFFQNKRni----rENSIELINSISHnpqsSSTGLEGLSESKKLHLQNVEKRLhf------------- 323 Saccharomyces...
CCF57676       233 YLGRMEYYLHMMELLQSRKirnnddnNSTNMLLNIISY----SNDEIEKVIEKNKQTRDVIMSDLskeislqqdnsndae 308 Kazachstania ...
Q6FX96         315 FLDRLEYHLDMFEYFQGKRaa----nETALGFLTGIKT-------ETSNLRDQNAQNRSRILKELksedql--------- 374 [Candida] gla...
XP_003675349   370 ---lpegsssektntesKHPTEHALPPAMg--------rRGIVFDE-SIKSPEDIDLKDIWSLYDPWMSLALDTSLSIKF 437 Naumovozyma c...
CCH58541       328 ------sdsqpnenseaDITERKKLRRSN----------RSIILGP-DKRNITDLDIPELWTMYNPWTSLALDTSLSIKF 390 Tetrapisispor...
XP_003685903   332 ------------gesdhQGQKSEHPP-------------RGIIMDD-ALTSPEEVDLGEMWYLYNPWMNLALDTSLSIKF 385 Tetrapisispor...
EDO18959       408 --------svpefdvikENTKDGTIPL------------RGIVFQH-EQTSPDDIDLEETWSLYNPWMNLALDTSLSIKF 466 Vanderwaltozy...
CAR23819       355 -----------------ESAPRQSMPVVSgqrq---sslKGILLDP-NIQSSEDIDLDETWSAFNPWLDLALETSLSIKF 413 Lachancea the...
Q751V6         304 -----------------DITPPRGLPLSPkavd---qglRSIILDP-DHESTEDLDLHELWSIYNPWVDLALDTSLSIKF 362 Eremothecium ...
ybcl:Ecym_1035 306 -----------------DSTPSHSIPLSIklsd---qgiRGVTMDI-TYDSADDIDLREMWSLHNPWINLALDTSLSIKF 364 Eremothecium ...
XP_002497981   307 -----------------KNAPEGSMALSSvasq--gfplRSVILEV-DPQDPDSMDLNEVWSLYDPWMNLALDTSLSIKF 366 Zygosaccharom...
CCE91562       333 -----------------TNAHKGSIPLSDkvqt---ypmRGVLMET-DNQSPEDFDLEEMWNLYDPWMNLALDTSLSIKF 391 Torulaspora d...
CCD22190       365 lpdppltllpptpsadgEAASSQMLPPTLn--------rNSIVLDQ-SLQHSKEIDLKEFWRLHDPWMNLGLETSLSIKF 435 Naumovozyma d...
P25573         324 ---------------laSSGDSISAPVKKrsst---tlsRGVILPH-DTKGPQDIDLDTIRSLYDPWMTLALETSLSIKF 384 Saccharomyces...
CCF57676       309 eepglrqditksissmmEQKRKQKVEHSSnll----vppRNVILDPiQVKTSEDIDLNEIWSLYDPWMNLGLDTSLSIKF 384 Kazachstania ...
Q6FX96         375 ------------sndlsIKTGNAKIPKGTqrhgfsaaanRSIILEE-DVAVPEDIDLNEIWTLYDPWLNLALETSLSIKF 441 [Candida] gla...
XP_003675349   438 IPTV 441 Naumovozyma castellii CBS 4309
CCH58541       391 LPTV 394 Tetrapisispora blattae CBS 6284
XP_003685903   386 LPTV 389 Tetrapisispora phaffii CBS 4417
EDO18959       467 LPTV 470 Vanderwaltozyma polyspora DSM 70294
CAR23819       414 LPTV 417 Lachancea thermotolerans CBS 6340
Q751V6         363 LPTV 366 Eremothecium gossypii ATCC 10895
ybcl:Ecym_1035 365 LPTV 368 Eremothecium cymbalariae DBVPG#7215
XP_002497981   367 LPTV 370 Zygosaccharomyces rouxii
CCE91562       392 LPTV 395 Torulaspora delbrueckii
CCD22190       436 IPTV 439 Naumovozyma dairenensis CBS 421
P25573         385 IPTT 388 Saccharomyces cerevisiae S288C
CCF57676       385 IPTV 388 Kazachstania africana CBS 2517
Q6FX96         442 IPTV 445 [Candida] glabrata CBS 138
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap