Conserved Protein Domain Family
UPF0300

?
pfam08594: UPF0300 
Uncharacterized protein family (UPF0300)
This family of proteins appear to be specific to S. pombe.
Statistics
?
PSSM-Id: 369983
View PSSM: pfam08594
Aligned: 12 rows
Threshold Bit Score: 274.937
Threshold Setting Gi: 34922445
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O94245       154 FLKKNRVDGLSLSMHFSTGNYSLPVLIRHVLLYDYYTDDMKDSLWRAMIIYVSRQVTSNKYTKFHLWCVQKRIGNIRMYL 233 Schizosaccharom...
O13699       152 AINYSPKTYTKIFDFLRNGRAPLQVLVHHCMLYNFYPEDFQDALWCAVQAHVMNQVRLGRATLLHARACYQKIGDIRMYL 231 Schizosaccharom...
XP_013024054 160 AMNYSSKIYLKLSDYFKHGKAPLSVLVHHVMLYEYYPEEFQDVLWSATQFHVMHQVRLNRASLLQARACYQKLGDIRMYF 239 Schizosaccharom...
XP_013024222 149 LLKSHRSLFNHLCEYLRAGPIPISVLIHHVMLFQFYPPEIQESLWIAVEHYLSN--YDFAHTKLLKLALQNRLGCIRMYL 226 Schizosaccharom...
O42654       148 LLRNHQALFKYLCDYLRSGEFPLTVLIHHVMLYQYYPKSLQEALWAAVEHYVNN--SGEAYSTVQKLAVQKKIGNIRMYL 225 Schizosaccharom...
XP_013023191 234 lFNSFENYFRELTEFLLNGRAPLNVLVHHIMLYHYYPTSMKDVLWKAVEVYLDIHCTEDRYCRVQVEAAKRRLGDIRLYL 313 Schizosaccharom...
Q10240       223 LLSTYENSYKELSEMLTNNNAPLEVLIHHVMLYHYYPSFLQSALWTAVSSYLEERCNNGLYSKLLVKAAKQHFGDIRLYF 302 Schizosaccharom...
O94713       500 SLVNKNSCIKRLHLKLSKGIMDIKVLTHQLMLYDLYPPAHQTYLWKALERLVNEKVSLGELTPVHKVAAEKRIGDIRMHL 579 Schizosaccharom...
XP_013021025 153 fFRKYRSDALSLCMHFATGNFTMPILIRHVFLYDYYPKEIQDSIWRAMLVYISQQVKNGTYTLFHYHCAQRKVGNIRMYL 232 Schizosaccharom...
XP_002174372 197 adrAFPEGFEQLALYLEEDNIPHHILLHHVMLFDIYPEKLKNIVWKAVSNYIHRNISCYGYSKIHWAAAERHFGHPRLLL 276 Schizosaccharom...
Q9USY0       179 AEKNFPEGFEDFVSFLENPNIPLTVLLHHVMLYDLYSNNLKDAVWVAVTNYMKNLVGNYGYTELHIRAAQQMFGHPRFLL 258 Schizosaccharom...
EPY53494     188 AEKNFPEAFEQFINFLRGPNVPMSVLLHHIMLYDLYSPRLKDAIWETVGNYLQKMKGSYGYTDLHVKVARYKLTHPRFIM 267 Schizosaccharom...
O94245       234 VRPGDVYSFQGQTSWAAICNKSYMCNIQLEQSPEVS--VKSSLPKYSNepiFQSKTISQEEVGWLLFMLSIGNHARAFPI 311 Schizosaccharom...
O13699       232 IDPHDLYFSPNSLKWLIICSKQFQALVHLEVKMDTLk-IFRRRSKYFN---LARSCVSGFELSWLIMMTSIGSNASAVPV 307 Schizosaccharom...
XP_013024054 240 IDPADMYVPPDSLNWLIICTKDFQGLIQLKRTMDAKk-LFQRRSKHLT---LAQFATSSSDLSWLCMMLSIGRNARALPI 315 Schizosaccharom...
XP_013024222 227 INPNDIYALKAKNNWVAVTRSNFLSYLQLRLPLCESs-LPYDLCGFEA---MLHSASSEADIGWLSMMHCIGNNGHAFPI 302 Schizosaccharom...
O42654       226 VNPRDIFALGSTCNCIVVSSSNFQSYVQLRKPLLENn-LPYEIDGFDK---ILQCANSEADIGWIAMIHCIGSNGYAFPI 301 Schizosaccharom...
XP_013023191 314 VYPRDIYKFTNSKDWIAVATRGFMSYIQTRNPLCLGs-IPVNNKSISE---LLSYTTSTDCMAWLSLLICAGSNGSRFPL 389 Schizosaccharom...
Q10240       303 VTPDDIYTFDHCNNWIAIVTRNFMAYIETKRKLEFDs-IPFNCPLITQ---LFPLISSPKEMAWLLLIVCTDSNESWFPV 378 Schizosaccharom...
O94713       580 IESSDIYVVTENHRWLHIVCEGFNCFLELPEVLHGKkfLKVDEATRED---MLMSAETPDDILWITTLISTGSSMSHFPL 656 Schizosaccharom...
XP_013021025 233 VKPDDIYRFQNQSDWAAISNKRFLCYMHLADESEQIv-MKREKVCKEY---FADVEISKGDLGWLFFILSIGVNAKAFPV 308 Schizosaccharom...
XP_002174372 277 VKPQDCFCVDDTNEWIAICNKRFHCSIFVDHNSFSEr-SETELIAFEE---LADMANEACEIGWLCFLASTGNQAAAFPI 352 Schizosaccharom...
Q9USY0       259 VHPEDIYCISGSSDWVCVSTQHFHCNIHVHSVSGNAi-RKSRNPIIQD---LSSICQNSTEFGWLALTHALRKKGAIFPI 334 Schizosaccharom...
EPY53494     268 IHPEEIFCVYNNPDWVCVSNKHFHCNIHIQPIVSNA--MKSSDDRIRE---VASNCQTPVEYGWLTLGLALRKKAAIFPI 342 Schizosaccharom...
O94245       312 QNYLA--NTVMETVLPVel-----rCPFLSRSVDCEIFQKNTKRRVMEKWRQEFKKDLNVCEEL 368 Schizosaccharomyces pombe 972h-
O13699       308 HAYLAskRILYPSIIPE--------EIFFMRKFDSSLFKDIKNIHELLGFLGRLFMDLQDCEKF 363 Schizosaccharomyces pombe 972h-
XP_013024054 316 HGYLSakKVLYPSIIPD--------NVFCMRQVDSVLFKEIHSIHQFLEFQGRLFMDLQDCQTF 371 Schizosaccharomyces cryophilus ...
XP_013024222 303 HMYMNtkDAVFEGKVPE--------SALFLYNTDAVLFKKDSFIRGFYDFCNQLLLDLCKCRQY 358 Schizosaccharomyces cryophilus ...
O42654       302 HLYLNmkKNIFLGKLPE--------STLLLYNSDGAIFKNPPSSKKECDFYNQLLLDLCKCRQF 357 Schizosaccharomyces pombe 972h-
XP_013023191 390 HKYINtkTRIMKSKTSI--------TDFLFSDEDLLFFQDKESITEFKPLQQQLLRELADCDAh 445 Schizosaccharomyces cryophilus ...
Q10240       379 HAYINtkTRILRPRSPK--------LDFFLKESDLLYFQDKQSISEFDIIRKDLLEDLIQCDSY 434 Schizosaccharomyces pombe 972h-
O94713       657 HAYLEakERQEFTKK----------NLLLFCKEDEFLYSDQENEDLLESFERVISEELSLLKSN 710 Schizosaccharomyces pombe 972h-
XP_013021025 309 HYYIK-------SIAPGvlrnddedCIFTYRPKDSLLFQKSSHRLRMTEWLKELRSDLEICKDq 365 Schizosaccharomyces cryophilus ...
XP_002174372 353 HAYFQslNEYSGITLPQ--------SLLYLKPQDNILFQGNVE-LVVNYIYDTMIEEALECETr 407 Schizosaccharomyces japonicus y...
Q9USY0       335 HAYLNfnAKLYEECIPP--------SILYFNKNDENINVGNIE-DITNYMYETFINEASLCDKF 389 Schizosaccharomyces pombe 972h-
EPY53494     343 HAYLNckTKLYDESMPP--------SLLYYLKEDENTNTSNIE-EIINYMYEIFNAEAALCGSL 397 Schizosaccharomyces cryophilus ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap