Conserved Protein Domain Family
KAR9

?
pfam08580: KAR9 
Yeast cortical protein KAR9
The KAR9 protein in Saccharomyces cerevisiae is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules. KAR9 localizes at the shmoo tip in mating cells and at the tip of the growing bud in anaphase.
Statistics
?
PSSM-Id: 369971
View PSSM: pfam08580
Aligned: 18 rows
Threshold Bit Score: 540.188
Threshold Setting Gi: 448122495
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EAS35694      422 SfSNQLSQLTSISLPQPSTLEASIAAIPTASAAVRALTQAAEQIQKWINKasevlsgldadddvewaaagGREGLDDVDK 501  Coccidioides ...
Q2ULQ5        435 SfSHQLTQLTSIPLPQPSSLEASIAAIPNAPLAVKSLTGSAAQIQIWIKKasdvlsgldaedevewaaagGREGLDGIDK 514  Aspergillus o...
GAA83788      367 SfSNQLSQLTSIPLPQPSSLEASISSIATAPAAVRALTGAAEQIQIWVKKasdvlggldaeddvewaaaaGREGLEGVDK 446  Aspergillus k...
Q4WHK4        457 SfSNQLSQLTSITLPQPSSLAASIAGISNAPAAVKALTGAAEQIQIWIKKasdvlsgldaeddvewaaagGREGLEGVDK 536  Aspergillus f...
Q75C93         41 I-KQDLLRLVNLLQDLKVSLKGTF--------SRDVVVSHMPQYFDWIQD--------------------GRGLFYPLYK 91   Eremothecium ...
XP_004204463   37 S-SHDFIKINKLVEDICLYLGSLNSLFKELNAAEEQHA----KQLGWYYE--------------------GKDQIQNLSQ 91   Pichia farino...
Q6BSY6         36 L-SHDLFKINKIVDDIFGYLSELLTMFRELR-NEKRVT----EDKRWFFE--------------------GRDGIYELVQ 89   Debaryomyces ...
CCE42518       44 S-HRDLFKISKVLDDIDLYLNDLIIAFNNIKEVSRHAS----NILDWFYE--------------------GKHALQSLFR 98   Candida parap...
Q5AKW6         65 S-QRDVFQITKVLEDINLYLNDLLMIFNNVEQASKNVV----DVLDWYFE--------------------GKSLLQDLLR 119  Candida albicans
EMG45378       58 S-QRDMFQITKVLEDINLYLNDVLMTFNNIQQASRNVT----DLLNWYFE--------------------GKAIFLELIR 112  Candida malto...
EAS35694      502 AVTKFESLINVYVKAIEDVQLRDDIAdvgANQLHAIVIQMESTLQNWSTVRSLLKGVKEQVELAMEWEELWNAVLGDVGL 581  Coccidioides ...
Q2ULQ5        515 AITRFEGLMNIYVKAIEDVQLRDDICnvsADSLKTIVIQMDSILQSWADIKNRLRNVKEQVELAMEWEELWNTILGDVSA 594  Aspergillus o...
GAA83788      447 AIIRFESLINVYVRAIEEVQLREDIGdvsTDSLQTIVVQMDTIIQSWANIKNRLRGVKGQVELAMEWEELWGNVLGDVTV 526  Aspergillus k...
Q4WHK4        537 AITRFESLVHVYVNAIEQVQLRQDIGnvsPDSLKTIVVQMDSIIQSWAQIKGRLKGVKEQVELAMEWEELWANVLGDVGM 616  Aspergillus f...
Q75C93         92 CFSQIEPAMLKFLDPLEAQQTSGALN----RDQVAIFNLIDQVSELVLSLKPLFQSVKNLFDTALEFNEIFKDHMNSLLE 167  Eremothecium ...
XP_004204463   92 NMENIDSIISRILALIETSKRFHEH--------ESTLSQIEQASDMLLEVKKHIIVLKKKVDIAVIYEELNETIMVSLLR 163  Pichia farino...
Q6BSY6         90 NIENIDSIISQLLGTVDA----HAHG---LPDFTSMLGKFEETSDLLLEVKKFLIVFKKKVDIAINFVEINDDIIETLTW 162  Debaryomyces ...
CCE42518       99 DMDSIDSIISRLLLRIESADSSTNIS-------QGLIRKFEEVSDVLLDVKKSSIVLKKNLDVSTNYHELMESVIKSLTA 171  Candida parap...
Q5AKW6        120 NIENIDSIISQLLLVVESSNNHESIG-------NNLLAIFEEISDLVLDVKKSSIMFKKYLDISINYREIIDSVIKSLSN 192  Candida albicans
EMG45378      113 NFDNIDSIISQLLSVLEATD--GGIG-------NNLFGVFEEINDLSLEVKKSSIIFKKYVEIAINYRELIDSVIKTLSD 183  Candida malto...
EAS35694      582 EIENLARLIFEMEEKRHKTvidm---dhePAHGLDINELETIVEESPANg---nTHSNQRFSFAPvFppggsqldiqasq 655  Coccidioides ...
Q2ULQ5        595 EVESLSRLLFEIEEKRHINmanawaadqeSNSGLDISELETIVEETPNNg---sFSNSNRHSI---Lfdapptldtpliq 668  Aspergillus o...
GAA83788      527 EVESLTGLIFEMEEKRHWTlage---qdsSASGLDINELETIVEETPSQa---qLLSSKRLSIDP-Iltgpptmdmpviq 599  Aspergillus k...
Q4WHK4        617 EIESLSRLIFEMEEKRHFTmane---qegTSNGLDINELETIVEETPSNg----dMASKRFSMGP-Ffseapplgmpiiq 688  Aspergillus f...
Q75C93        168 EIEGNMKKCLALHQDCFAS----------PVRHPPSFTLDQLVELISSS------SNNQRLQMPT-F------------- 217  Eremothecium ...
XP_004204463  164 EIEDCIKWYMRISEIKMSS----------PSKHLPKFNMEQVIAKMRINdvtksTFTTKSIQPPP-F------------- 219  Pichia farino...
Q6BSY6        163 ETEQCIDIYRKLLDMKLSS----------PKRHLSKFNLEVIISKMKINnltstNFSTKSLRLPT-F------------- 218  Debaryomyces ...
CCE42518      172 EIDECTKSVIKMKEHKLSS----------PKRVLPQFNLNEIVSKMKINeftstAISVKSVRLPT-F------------- 227  Candida parap...
Q5AKW6        193 EIEDCIKCILKLKELKLAS----------PKNVLPNFTLQSIISKMKINdlssgTFSFKSMRLPT-F------------- 248  Candida albicans
EMG45378      184 EIEDCIKCVLKLKELKLSS----------PKKVLPEYTLQTIVSKMKINdlsngTFSFKSMRLPT-F------------- 239  Candida malto...
EAS35694      656 NPQDe---ASLLALFARMQPLRASL-DFLPMRLSMFQSRAE-----KVFPSACQELEDRRHRLEKGYRKLETDAEALRRE 726  Coccidioides ...
Q2ULQ5        669 TPQDdsehADLIAVFARIQPLRASL-AFLPMRLSMFQCRAE-----RIFPSACAEMEERRKGLEKSYRTLEADAEALRKE 742  Aspergillus o...
GAA83788      600 TPHDdtnhSNLIALFARIQPLRASL-DFLPMRMSMFQARAE-----RIFPSACEELEERRGHLEQSFQKLEQDADALQKE 673  Aspergillus k...
Q4WHK4        689 TPQDds-hSSLMALFARMQPLKASL-DFLPMRLSMFQSRAE-----RIFPSACEELEDRRNQLVKSYKTLEADAEALRKE 761  Aspergillus f...
Q75C93        218 NPLEkriyQDYCELENAIVPIQTSLrDVLKTRIQMFRDRDI-----INLNYLMRLLNHKYANIVEKYDHFHSELMALKAG 292  Eremothecium ...
XP_004204463  220 NEVDeafyKDFLSLKERLTPINVSL-QYLPIKIEEFKFVCQslgpnVFLKDSINETQLRHKRLFERWTYLQSKMNELKND 298  Pichia farino...
Q6BSY6        219 NELDehlyNEYLDLEARISPLKVSL-EYLPFRIEEFNIFCKsisvsHLFPNSLPEIEKNHTNLMKRWEYLQNGLRIIKKE 297  Debaryomyces ...
CCE42518      228 NDLDqdlyDEFLDVEKKILPLRISL-DIVPSKIEEFNTICSs----SSFKVPREHVLSSYELMLDKWRYLEKQFKLLKRE 302  Candida parap...
Q5AKW6        249 SDLDeklyNDYLELESKIDPLRTSL-SIVPLRIDDFNTMCAg----QFFVKSRENVLDAYEVLVSKWNMLLKEKNSYKKD 323  Candida albicans
EMG45378      240 SDLDeklyNDYLELDSKIDPLRISL-SIVPVKIDEFNTMCSg----QLFVKSREIVLDTYENLVQKWNLLLKEKNTFKKE 314  Candida malto...
EAS35694      727 LGEDRWIVVFRNAGKQAHKMCESVERSVNKLQEAIDggiqhNNPAALAKRAENFEAKKVHYGSAIERVLSIIKKGINDRL 806  Coccidioides ...
Q2ULQ5        743 FSEDRWVLVFRNAGMQARKMFLSVERSIAKLQEALEtgahvHNPAGLAKRVESYEAKKQHYVPAIERVISLIEKGVKDQL 822  Aspergillus o...
GAA83788      674 LNEDRWILVFRNAGGQAQKMFDSVERSIAKLQEAIEtcahlHDATLFTKRIESYEAKKQHYVAAIERVVSIIRKGVDDRL 753  Aspergillus k...
Q4WHK4        762 LSEDRWILVFRNAGAQAHKMFESVERSIAKLQEGIEtglhvHNPAGLTKRIESYEAKKVHYVPAIERVISIIEKGVKDRL 841  Aspergillus f...
Q75C93        293 IIDKRWNVLFTNLNMELASILTSVTRMYESLQD---------NPTISGDTRDTLIQQIQQKSDTIFKTFEVIYKAL-DAS 362  Eremothecium ...
XP_004204463  299 VIDTKLNQVFSYLMHEISSKCDALSQDLQNNNSTVN----------------IDEIGATYKICC--NSITLLSKAFLEET 360  Pichia farino...
Q6BSY6        298 TLDSKWNDLFTYLIHEIIFKCDFLIDSLQDKHDEQT--------------LITDEIGTMYKLCS--NSITLIIKAFAEST 361  Debaryomyces ...
CCE42518      303 NIDCKWNEIFLYLIKQIEKECNELIDVLAFSDTTST----------DGNSTISEDIGSRYKVCS--NSMNIIESAITEGI 370  Candida parap...
Q5AKW6        324 NINVKWNEIFEYLIEEIFKECGRLIREVGSSSSNVTi---pPATGGGGGTTITDEVGNKYKMCS--NSITLIQKAFKENI 398  Candida albicans
EMG45378      315 NINVKWNEIFSYLIEEIYKECDKLVKKIDSTPSDDI---------PTASLVITDEIGSKYKMCS--NCVTLIQKAFKENV 383  Candida malto...
EAS35694      807 TVNGEVIRLLA-DLRARYEALQDKM------------------------------------------------------- 830  Coccidioides ...
Q2ULQ5        823 TVNGETVNLLS-DMASRMDALKRSV------------------------------------------------------- 846  Aspergillus o...
GAA83788      754 TVNGEILRLLS-DMTSRVDALKASV------------------------------------------------------- 777  Aspergillus k...
Q4WHK4        842 TVNGEIMRLLS-DMSSRIDALKASI------------------------------------------------------- 865  Aspergillus f...
Q75C93        363 ILNPNVAEVTN-TLADKWLVLREKVdpilpkete---------------------------------------------- 395  Eremothecium ...
XP_004204463  361 ITDGALANYFNdTLLSKWQTVSDLLadvgnpsdsntvtktrnskrdasmraynikpfvt-------eikqpkktnnslgi 433  Pichia farino...
Q6BSY6        362 IYESSLASLFNeSLVPKWQILNELLsgslnpsgtisniasvsglngnnlkayytfrrsptpe-ssnkevfpkksdhglgi 440  Debaryomyces ...
CCE42518      371 TTDREIPQTFNkKLHPKWMEVNDLIlrakadsdareikferkkesapkstglrqfrtvske---syndafdrpmsngmgi 447  Candida parap...
Q5AKW6        399 ITDPELVTIFNhDLVPKWEELNNIItnngnqsrtekrismyggtgsvsgstvesnglrsfqtgsrssssgerpisngigi 478  Candida albicans
EMG45378      384 ITDHELVTIFNhDLVPKWNQVNDLIsndgkprtqkrqsvhlnsiesnglrsfqtgsrns------tistpdkpvsnglgi 457  Candida malto...
EAS35694      831 -------------------SIMDSVLE-------ELTATK----GQQLRDSVSSIV------------------------ 856  Coccidioides ...
Q2ULQ5        847 -------------------EVMDSSLT-------EYNVAP----GQHLRDSISTIV------------------------ 872  Aspergillus o...
GAA83788      778 -------------------RVMDEWLE-------DINFVR----SQHLRDSISSIM------------------------ 803  Aspergillus k...
Q4WHK4        866 -------------------KVMDSSLD-------DLSLAK----SQHLRDSISTIV------------------------ 891  Aspergillus f...
Q75C93        396 ----------sdpidvltkRMSDMTIS-------EPVDSKpfhfDRSKRCSVGALLlrkmnikpilts------------ 446  Eremothecium ...
XP_004204463  434 dlgldvasskvpysiekkdRVKNVLRE-------KHDNST----KRSLKDALVSISssdendndndneenlmrkktnrhs 502  Pichia farino...
Q6BSY6        441 dlgvdvassrvafsiekkdRVKNFLNA-------EPSNNT----KRDLKQSLINIEndantklef--------------- 494  Debaryomyces ...
CCE42518      448 dfnvdvesvtmplsvtkkdRVKDFLTE---------EKPK----GKDLKGSLIQVFegln-------------------- 494  Candida parap...
Q5AKW6        479 dfnlavestsvplsvhksdRIKDVISSagtgapsEGIPPR----SKNLRHSLISVFedss-------------------- 534  Candida albicans
EMG45378      458 dfnievdttsvpisvqkseKVKDVVSAgt---nsEKPISR----GKNLRHSLISVFedst-------------------- 510  Candida malto...
EAS35694      857 ------------TLDTPPTRSAFDTPESS--PASSVIMANGA--NNAKSNG------------SRRSSTTgsti---sra 905  Coccidioides ...
Q2ULQ5        873 ------------TMDSPAT-SLIDTPGSS--PPSSVVMTPANkgSGASmg-----------ssSRRGSSVgsv----ars 922  Aspergillus o...
GAA83788      804 ------------TMDSPLTGSVADTPGSS--PASSVVMTPANplKGSATPmg---------tsSRRGSSVssa----art 856  Aspergillus k...
Q4WHK4        892 ------------TMDSPLASSVVDTPGSS--PASSVVMTPGNglKGSATPln---------psSRRGSSVgcsa---trt 945  Aspergillus f...
Q75C93        447 dpdeaekpkfnrSYRSPSSADANGSPISSdyPPVPFSLEPVH---------------------SKNPPVFklqigspdqp 505  Eremothecium ...
XP_004204463  503 lmtnvstetmftKDDDEVTLVSNKTPNIPisSCMSPIKEP-----------------------LEVKDIFevkelreslp 559  Pichia farino...
Q6BSY6        495 ---ldkgdndsfKEDDEITLVNSKTPKLPfeidni----------------------nhkvtkLKIQDTYeseki-wnsv 548  Debaryomyces ...
CCE42518      495 ---------lhdREDEEETLV--KTPVLNgpvkl-------------------------ktqqRQKVVSFdfdsy-tnni 537  Candida parap...
Q5AKW6        535 ---------mreDEDEATTLV--KSPSSKvvKEENQTCGQNKdfNNSFEKSqklie---nnqhQSEQNRIdfaay-iekv 599  Candida albicans
EMG45378      511 --------iahdYEDESTTLV--KSPISKkiKELEEEEKQQQ----QQQQPhevvevkqteesRKVEKKIdfaay-fenv 575  Candida malto...
EAS35694      906 AASKLKRYSALPQPVSPSgqt--------prR----AQAPRSssASNAYLKspTPRLTTTSPSP---TPPSRPGSRADGP 970  Coccidioides ...
Q2ULQ5        923 TVAKVRRYSGIPQPTATLtv----------kK----SAIPKP------ILTapSPSKPSGLYTP---TPAAKKVPRPPPP 979  Aspergillus o...
GAA83788      857 TMSKMRRYSGIPQATAALts----------kK----SSLPKP------SLTapSPSRMGAA-TP---TPAARKPVKPAPS 912  Aspergillus k...
Q4WHK4        946 TMSKVRRYSGLPQAASAL-------------K----SAIPKP------TFSatSPSKKDTAITP---TPATRKISRVPPP 999  Aspergillus f...
Q75C93        506 PVVKLQNENVCTEDKKTL-----------------------------------APSNTATAEPIgatQMQLNPEYPCSPP 550  Eremothecium ...
XP_004204463  560 CKDNLTKNSKIPIINKNYielglpiipkrlqPecgrSKIPILrpKLGYEENsfLKSNNVNSLQPavhIPYNEPKGRWQPS 639  Pichia farino...
Q6BSY6        549 INSKFSFPSRIPIILEDYinqglpvikkkylTkakhSRIPTIspNHPIFIDspERPSEIISLKP---------------- 612  Debaryomyces ...
CCE42518      538 LNSSARPASKLPRIVSNYielgypk----itkrggfTKIPEIdvTHPVFQS----------------------------- 584  Candida parap...
Q5AKW6        600 IHSPIKIESKLPKIPLEYikqgch--ithkrPdfanTRIPRVilMESPYSS----------------------------- 648  Candida albicans
EMG45378      576 INSSMKVESKLPSVSPDLikrghp--iiekdPgserSKIPAAgsNKSGLGS----------------------------- 624  Candida malto...
EAS35694      971 TLl----SKPRWNNSSNTNDLIVGHNFKPLSLSTPSphr--klPVPSRTTPS------TLP-PRSPLSRESSASP--AP- 1034 Coccidioides ...
Q2ULQ5        980 AKd----NRPRWNSSVNTNDLEVGHVYKSNTPFRKS-------SAPGRTSRPl----sMMS------RRDFAVSP--APs 1036 Aspergillus o...
GAA83788      913 PIp----NRPRWTNSTNTNDLYVGHVYKPNPTPRKP-------SASGRTSRPs----sTIP--MGPFRRDMSVSP--APm 973  Aspergillus k...
Q4WHK4       1000 PSpl--nNRPRWTTSTNTNDLEVGHVYKSSTPFRKS-------SAPARTSRPs----sTLP-MPNPRRRDQSASP--APl 1063 Aspergillus f...
Q75C93        551 PPgdpqpTSPAQNATRRPSDASLGYPGSHKDPQSPSa------PFLSAGSSA----------PVSPREAPATKSPslSPk 614  Eremothecium ...
XP_004204463  640 -------------------------------------------PTPVREQLS-----------TTPKILTKVRRP----- 660  Pichia farino...
Q6BSY6        613 ----------------------------PLFLINRSntivhpsPTPTRSR-------------IQPDEDDVFRKP----- 646  Debaryomyces ...
CCE42518      585 -------------------------------------------PYKGISQHSnr--tiTNGfDISPPSIKDHSDP----- 614  Candida parap...
Q5AKW6        649 -------------------------------------------PQSNAKRLEklnaanGVGsFVSPLRNKKNESY----- 680  Candida albicans
EMG45378      625 -------------------------------------------PHASSGRNYqenngdDLGsLVSPFKQRKSGSL----- 656  Candida malto...
EAS35694     1035 GL-------------------------RP----PSRLGRGAASPLPDRGISPTPk------------------KSSIIDP 1067 Coccidioides ...
Q2ULQ5       1037 TT-------------------------RSpsrvSSRVSSRLASRSPNRTGSPTP-------------------NRSLLDP 1072 Aspergillus o...
GAA83788      974 TA-------------------------RS----MSRVSSRLTNRSPERMGSPTP-------------------NRSILDP 1005 Aspergillus k...
Q4WHK4       1064 TA-------------------------RS----VSRVSSRLSSRSPARGASPSP-------------------GRSILDP 1095 Aspergillus f...
Q75C93        615 DCrpefdhmeppdffrsgedsytwrrdRSrnssVSSASAGELSGKLLLSASPQSsqpgdftacttapneddvsPTSLVSD 694  Eremothecium ...
XP_004204463  661 --------------------------------------ARVVSAKPLEYSLQSS--------------------VPTLDL 682  Pichia farino...
Q6BSY6        647 ------------------------------------------SRKPSIIRSTNSivsg------------qlsRTSSLSE 672  Debaryomyces ...
CCE42518      615 ----------------------------------FYISRSRASSTATVIGRPNS----------------------LLNE 638  Candida parap...
Q5AKW6        681 ----------------------------------S-FNRSRASSNATVIGRPNS----------------------LLHE 703  Candida albicans
EMG45378      657 ----------------------------------FVSGHSRTSSNATVIGRPNS----------------------LLNE 680  Candida malto...
EAS35694     1068 PPYSK--LRKtvpapspvvtGLPSTPRSRQSYAGTPSVRDTSVSGRng--deKks---sRPGTAMGYS---YRRVSLLP 1136 Coccidioides i...
Q2ULQ5       1073 PPYSK--LRRppg-----aeGINNTPRNRQSFAGLSFGRSVSHDYNrgllspTka---eRPGTALGHGg--SRRISLLP 1139 Aspergillus or...
GAA83788     1006 PPYSK--LRRp--------dGMSNAPRSRQSFAGLSFSRSVSHDHErniaspTkt---pRPGTALGHSa--NRRISLIP 1069 Aspergillus ka...
Q4WHK4       1096 PPYSK--LQKpd------paGLANTPRNRQSYAGMSFSRSVSQTHDssmlspTkt---tRPGTSLGHSgtgNRRISLLP 1163 Aspergillus fu...
Q75C93        695 DYIKQadHIK----------YIERIEEERFRYYANMHSRIPVMFSDlipqpiHlshfprSPGTR--HNywsSRLKEPtp 761  Eremothecium g...
XP_004204463  683 SRTPSltLPA------------------SPAYRSTSPDR---------------------PSSSVDSRfdeKHLVQPIK 722  Pichia farinos...
Q6BSY6        673 TTTPNlvYQQ------------------SPTYRSTSPDR---------------------PSSVIGSRfdhKHLVHPIK 712  Debaryomyces h...
CCE42518      639 ATIPNltYSR------------------RLSYNCTSPER---------------------PSSSLGSRfddENLLKslh 678  Candida paraps...
Q5AKW6        704 MKVPNltFSK------------------RLTYNLESFHESGGVGGGi------------gGFSSFESRfdeENLLHSLK 752  Candida albicans
EMG45378      681 MKVPNltFSK------------------RLSYNLEGLHEG--------------------ALSSYESKfdeENLLQALR 721  Candida maltos...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap