3JCR


Conserved Protein Domain Family
PRP3

?
pfam08572: PRP3 
pre-mRNA processing factor 3 (PRP3)
Pre-mRNA processing factor 3 (PRP3) is a U4/U6-associated splicing factor. The human PRP3 has been implicated in autosomal retinitis pigmentosa.
Statistics
?
PSSM-Id: 400749
View PSSM: pfam08572
Aligned: 119 rows
Threshold Bit Score: 111.526
Threshold Setting Gi: 148805896
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JCR_K       308 NTFFD----------PRVSiapsQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEIs---------QAARKT------ 362
XP_003679017  43 NPYLStstl---rsnDKVT----KRLERGLKFHEKGEVSSQIERQREEQRLEYERQKEqeilnkirreKEQAETsak--- 112 Torulaspora del...
XP_001643871  39 NPYLStnnqspnssyRKVH----ERYRKGLKFFQKGEISAKYELERKVKADEEARQQEederkrikeeEEQEILkvk--- 111 Vanderwaltozyma...
XP_003684635  49 NPYLNfhdakgeanyKKVN----DRLHRGLVFHKKGEITAEYEKQRLL--------NKkkkrkriygeKTQEKLekekln 116 Tetrapisispora ...
CCD26280      68 NPYLStfntq-pstkTRKG----QRIQ---TFFQPGEVSKRIQHERELQRKVLEQERKfnelerqrrtKEDEVTklk--- 136 Naumovozyma dai...
XP_003673750  74 NPYLStlnkh-tgyeNKIH----KRYQRGLSFFQKGEISSKISDERQVQREELERNRQfnerekirleKEDKKRrik--- 145 Naumovozyma cas...
EJT44622      68 NPYLSdiqg--pspsNKLN----RRYERGLKFYKKGEISKRIAQERELRKFQEDEDSKrrl----kleEEERERekl--- 134 Saccharomyces k...
CCH61325      44 NPYLQdsss--kfvdYKLQ----RRFDRGLKFFKKGEKLNEIAKKRKIIHDSIEKNKLelqlqnelerKRLNDLrtk--- 114 Tetrapisispora ...
Q6FJ58        41 NPYLSdig----qqnGKVF----KKYKDGLRFYKKGEISAQLHKEREELARRLKEEELraaaekahrvSLAEQKrer--- 109 [Candida] glabrata
CAR24844      45 NPYLSrerf--dtvaSKVS----KRYSRGLKFRTPGVLAKELDEKRAwlake-----------relqkEQDNLRkak--- 104 Lachancea therm...
3JCR_K       363 ----GIHTSTRLAliapkkelkEgDIpEI------EWWDSYIIpngf---dlteENPKRe----------------DYF- 412
XP_003679017 113 -iarGELPDTKVGedkyirrieD-VPe-V------EWWDKPYLddq-----lnvLPKYQggyee--------esesDEEd 170 Torulaspora del...
XP_001643871 112 -vanGELPDFSTGenkylkdltN-IPt-V------EWWDKPYLddr-----leiFDKYRvpcregdn--tdeeeeeDEDf 175 Vanderwaltozyma...
XP_003684635 117 kikeGLIPNHVIGedkyftaveD-IPd-V------EWWDRPYLden-----nniLEKYDkqftvdd---vseseseVEDd 180 Tetrapisispora ...
CCD26280     137 -iqnCELPDLALGedkyipnvdD-IPd-C------EWWDVVYLdttd---ktkiLDKYSmqypsve---ededfvsDEEd 201 Naumovozyma dai...
XP_003673750 146 -ierGELPDLELGedkyilkasS-VPt-V------EWWDLPFLeeks----lqiLDKYSmpypnd------edfisDEGd 206 Naumovozyma cas...
EJT44622     135 -vesGHLPDLKLHedtyildlpK-FEtYYnanhghEWWDTVYLdek-----gevMEKYRmkgtspaeedgkydnddDDDd 207 Saccharomyces k...
CCH61325     115 -ienAELPDQTKNeekylksieT-IPk-V------EWWDEPYLnetsnsdtltlVDKYRndysnl-----nedddsDEDd 180 Tetrapisispora ...
Q6FJ58       110 -ianAEIPDDSIGeelymqrfkD-IPn-Y------EWWDESYLdks-----gniLPKYTteypedmd-sdydsddmNSGv 174 [Candida] glabrata
CAR24844     105 -vraGELPDESIGeqny--litD-VPq-I------EWWDAIYVqspe---dwtiKTKYSksygtm------dedsdDEQd 164 Lachancea therm...
3JCR_K       413 ------------GITNLVEHPAQLNPPVDNDTpv-----tlG-VYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEP 474
XP_003679017 171 e----------vPSIQYVHHPVPIKVH----Npk-----ptTkVYLTKKEQKKIRRNKRKFEREEKETRIKMGLDPKPEP 231 Torulaspora del...
XP_001643871 176 de-------nmkPSIRYVLHPIPIKV-D---Evv-----pvSkVYLTKTEIKKARRNRRKIEREELETKIKLGVLPKPAP 239 Vanderwaltozyma...
XP_003684635 181 erns---eivshPSIRYVQHPVPIKLGD---Rnr-----lvSkIYLTKTERKKLRRNRKKLEREEKETKIKLGILPKPEP 249 Tetrapisispora ...
CCD26280     202 ee-------erhPSIRYIQHPVPIKM-ELSNQgg-----rpNkVYLTKKEQKKIRRNKRKLIRQEIDEKIKLGLEPKPVP 268 Naumovozyma dai...
XP_003673750 207 ve-------eihPSIRYIQHPVPIKV-E---Evk-----ikDkIYLTKKEQKKVRRNTRKLIRQEKEEKIKLGLEPKPLP 270 Naumovozyma cas...
EJT44622     208 dd-------dkhPSIRYVAHPIPEKI-N---Yak-----vsVkTYLTQRERKKIRRNRRKMFREAQEVKIKLGLLPKPEP 271 Saccharomyces k...
CCH61325     181 ed-------glhPSLRFIQHPVPIAAKA---NstsessvviPkLYLTKLETKKLRRNNRKLIREEKESRIKSGLDPKPDP 250 Tetrapisispora ...
Q6FJ58       175 ecmksqteetgpPSIRYVQHPVPIKI-P---Eei-----taPkMYLTKLEHKKARRRNRKLQREEKMAKVQLGLEPKPET 245 [Candida] glabrata
CAR24844     165 se-------sesPSVRYVQHPVPVQAAE---Hap-----skPkIYLVKREQKKIRRNRRKLLQEEHEQKIKLGLEPKPAP 229 Lachancea therm...
3JCR_K       475 KVRISNLMRVL-GTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLT 521
XP_003679017 232 KVKLSNMMSVYeNNQNITDPTQWEHTVIEQVEQRKRKHLETNMIRHEE 279 Torulaspora delbrueckii
XP_001643871 240 KVKLANMMSVYeNNQNITDPTSWEKTVRNQVEERKRKHEDMNLQRHEE 287 Vanderwaltozyma polyspora DSM 70294
XP_003684635 250 KVKVSNMMNVYeNNQNITDPTQWENTVREQVEERKRKHEETNKIRHEE 297 Tetrapisispora phaffii CBS 4417
CCD26280     269 KVKLSNMMNVYeNNQNITDPTSWEVTVKQQMEERKRKHEEINQKRHEE 316 Naumovozyma dairenensis CBS 421
XP_003673750 271 KVKLSNMMNVFeNNQNITDPTTWETTVKQQVNARMRKHEEENNERHEl 318 Naumovozyma castellii CBS 4309
EJT44622     272 KVKLSNMMSVYeNDQNIADPTAWEKTVKDQVDLRKRKHMEENERRHEE 319 Saccharomyces kudriavzevii IFO 1802
CCH61325     251 KVKLSNMMAVFeNNQNITDPTAWENTVKTQINDRKQKHLQENEKRHLE 298 Tetrapisispora blattae CBS 6284
Q6FJ58       246 KVKLSNMMNVLdNNKNISDPTAWENMVKDQIEERRQRHIQENEKRHEE 293 [Candida] glabrata
CAR24844     230 KVKLSNMMSVYqNNENITDPTSWEQTVKAQAEERHQKHVETNIRRHYE 277 Lachancea thermotolerans CBS 6340
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap