2I5B,1JXH,3RM5


Conserved Protein Domain Family
Phos_pyr_kin

?
pfam08543: Phos_pyr_kin 
Click on image for an interactive view with Cn3D
Phosphomethylpyrimidine kinase
This enzyme EC:2.7.4.7 is part of the Thiamine pyrophosphate (TPP) synthesis pathway, TPP is an essential cofactor for many enzymes.
Statistics
?
PSSM-Id: 400725
View PSSM: pfam08543
Aligned: 120 rows
Threshold Bit Score: 189.61
Threshold Setting Gi: 74560641
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2I5B_E  13 DSSGGAGIQADLKTFQEKNVYGMTALTVIVAMDpnNSWNHQVFPIDTDTIRAQLATITDGIGVDAMKTGMLPTVDIIELA 92  Bacillus subtilis
Q8TXS1   9 DPT-GAGLRADIATAEALGVPAVSLPTLLSLQD---EGVELVEPVDSRFLSDCLARYVP--RCEVVKVGAVPTLKTFEIL 82  Methanopyrus kandleri
O28075  11 DPSGGAGVSADIKTAKAIGLYPASVITSLTVQN--TCGVKAAIPVEAEVIREQLRAVIEDMKIDCIKIGLITSVEIAKVL 88  Archaeoglobus fulgidus
Q6FDT4  12 DPSGGAGLQADIESIGQSGAHAAIACTALTIQN--SQQVFGFEATSKELLLAQANAVVVDLPIKCVKSGMLGTTENIAAL 89  Acinetobacter baylyi
Q9HX41  17 DPSGGAGLQADIEALLAQGCHAAPAVTALTVQD--TVNVSDFRVLDREWVLAQANAVLADLPVAAVKLGMLGSLEMVDTV 94  Pseudomonas aeruginosa
Q87VY7  17 DPSGGAGIQADIEALLAQGCHAAPAITALTVQD--TVNVSDFRVLDREWVMAQANAILNDSSVAAVKLGMLGSLEMVDTV 94  Pseudomonas syringae ...
Q60B53  41 DPTGGAGIQADIEAVGAIGCRACTVITALTIQD--TSNVHAVQPQSPDAFLAQGRALIRDLPVAAVKIGLLGSAGIAHCV 118 Methylococcus capsulatus
Q82UQ6  15 DPSGGAGIQADILTLAGMGCHPLTVLTAVTVQD--TTGVEDIFVMDAEWVTDQARTVLQDMPVQAFKIGMLGSVEIISAI 92  Nitrosomonas europaea
Q7P1R2  17 DPSGGAGIQADILTLASLGCHPLSVITAITVQD--TVGVNDLMVLDSDWVNDQARFLMEDMPVAAFKIGMLGSVENVAVV 94  Chromobacterium viola...
Q63RH6  16 DPTGGSGLQADLMTLASMGCHGVSVLTGYTVRD--SAACDEVTGLDPDTVAAQARMLLEDMPVAAFKIGAATRAEVVSAI 93  Burkholderia pseudoma...
2I5B_E  93 AKTI-KE-KQLkNVVIDPVMVCKGANEVLYPEH-AQALREqLA-PLATVITPNLFEASQLSGmDELK-TVD--DMIEAAK 165 Bacillus subtilis
Q8TXS1  83 AKRLrDL-----TVVWDPVFRAEAGGELSEATP-EEALE--TFgETVDILTPNTEELSQLVG-REVR-TTV--EAELAAR 150 Methanopyrus kandleri
O28075  89 AAELvPL--NA-PKVLDPVIFAGAGGKIGDEEA-YKM----IL-KHVDIVTPNLTEAITLLE------STK--EARELAL 151 Archaeoglobus fulgidus
Q6FDT4  90 AQFLrEH-PDY-QYVLDPVLVANSGGSLGDQATlVKAFVE-LI-PLATVITPNTVELRALTG-------LD--NIEDATQ 156 Acinetobacter baylyi
Q9HX41  95 AEILaAH-PHL-PVVCDPVLRAGGGGALGKGDV-GFAMRErLL-PRATIATPNLPEARLLA-------DLPegSADQCAE 163 Pseudomonas aeruginosa
Q87VY7  95 VELLqAN-PHV-PVVCDPVLRAGGGGRLGKDEV-GYAMREqLL-PLSTIATPNLPEARILA-------ELPegTADECAA 163 Pseudomonas syringae ...
Q60B53 119 ATLLdELgGGV-PVVLDPVLAAGGGTDLASEEL-IEAVRTeLL-PRAVLVTPNVPEASRLGGg---------aTEAENAE 186 Methylococcus capsulatus
Q82UQ6  93 AEIIsDY-PDI-PLVLDPVLASGRGDTFANEEV-IAAMREmLF-PQATIVTPNSMEARRIAL-DDED-DPEilDLKQSAD 166 Nitrosomonas europaea
Q7P1R2  95 SQLIaDY-PDI-PVVLDPVLASGGGHELADEDL-IGAMRDmLI-PQVSILTPNSLEARRLAS-NDPD-EDEelTLDQCAE 168 Chromobacterium viola...
Q63RH6  94 AEVVaDY-DGV-PLVLAPDFTLDDEHVLAADDL-RESIADlLA-PQTTLLVADHATLIALAQ-PDGDaEAP--NLDAALS 166 Burkholderia pseudoma...
2I5B_E 166 KIHA-LGAQyVVI--TGGgKLkhEkAV--DVLY-DGETAEVLESEMIDTPYTHGAGCTFSAAVTAELAKGAEVKEAIYAA 239 Bacillus subtilis
Q8TXS1 151 ELVEeYGLTgVLV--TGG-Hs----VDrrDVWV-PAEG-NTIAWEVPPGEGAHGSGCVLSTALACFLVRGLDPETAVERA 221 Methanopyrus kandleri
O28075 152 EMNKkYGCDvVI---TGGe------LGgkDVVC-EAGRTYTVSAEFSP-VNIHGTGCVYSTALACYLGLGNSLENAVRKA 220 Archaeoglobus fulgidus
Q6FDT4 157 KLFD-MGAQaILV--KGG-He-aTpDHihNQLFiKGELVAESTCPRLE-GEYHGSGCSLASYIAGRLALGDDLKIAVQHA 230 Acinetobacter baylyi
Q9HX41 164 RLLE--HCEhLLI--TGG-HG--DeSEvhNRLYsRDGSRRTFTCQRLP-GSYHGSGCTLASALAGRIALGEALHGAVQSA 235 Pseudomonas aeruginosa
Q87VY7 164 KLLP--FCQhLLI--TGG-HG--DeQQihNRLYtRGGQTHTFICERLP-GSYHGSGCTLASTLAGRLAQGEELVSAVKSA 235 Pseudomonas syringae ...
Q60B53 187 RLRL-LGCPnVLI--TGT-HA--PtDDvvNRLYsSTG-KRDYRWPRLP-YSYHGSGCTLAASVAGYLALGHAMDAAVEWA 258 Methylococcus capsulatus
Q82UQ6 167 RLLQ-WGCGyVLI--KGA-HE--NtPEvvNILYdANGVVRSDAWQRLP-GSFHGSGCTLSSAIAASLAHGMSIMDSVYEA 239 Nitrosomonas europaea
Q7P1R2 169 RILA-LGSPyLLI--TGT-HE--NtKEviNSLYgQDGVVRADHWERLP-GSYHGSGCTLASAIAGMLATGLLLPEAVREA 241 Chromobacterium viola...
Q63RH6 167 HLLG-QGCEyILAteTGS-H------RlvNTLYgEEGQIRQDLWERTP-HRLMGITDTLGAAIAALLANGQEPPEAVREA 237 Burkholderia pseudoma...
2I5B_E 240 KEFITAAIK--ESFPLNQY-VGPTK 261 Bacillus subtilis
Q8TXS1 222 VRFARAAVReaRNTPFGRV-ADPVA 245 Methanopyrus kandleri
O28075 221 RIFVLESVK--KALRPGs--CFPVV 241 Archaeoglobus fulgidus
Q6FDT4 231 EVWLFDVLK--QAEMPA-----P-N 247 Acinetobacter baylyi
Q9HX41 236 LDYTWRTLR--DAESPGHGqYVP-R 257 Pseudomonas aeruginosa
Q87VY7 236 LDYTWRTLR--DAEQLGRGqFVP-R 257 Pseudomonas syringae pv. tomato
Q60B53 259 QRFTWQSLR--AGWTPGDGqHLPLR 281 Methylococcus capsulatus
Q82UQ6 240 QDFTWHTLK--AGFRPGMGqYIP-D 261 Nitrosomonas europaea
Q7P1R2 242 QEYTYQTLL--NGFRPGMGqFLP-D 263 Chromobacterium violaceum
Q63RH6 238 QEYLYQAAR--DAFRPGMG-Aylpd 259 Burkholderia pseudomallei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap