6AWL


Conserved Protein Domain Family
COQ9

?
pfam08511: COQ9 
COQ9
COQ9 is an enzyme that is required for the biosynthesis of coenzyme Q. It may either catalyze a reaction in the coenzyme Q biosynthetic pathway or have a regulatory role.
Statistics
?
PSSM-Id: 400696
View PSSM: pfam08511
Aligned: 157 rows
Threshold Bit Score: 41.3721
Threshold Setting Gi: 449542953
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6AWL_A              210 PHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMN 282
jgi:Astex_2543      133 PQHLGLYRRLLWGSADLVWRKAGDKALDENHYSKRAIVSGILATGL---MTRLTQGAEAQHEQIARNIEQVMA 202 Asticcacaulis e...
zuci:PHZ_c3285      116 PQNMALGGRLAWESADVLWRWAGDTATDENHYSKRAILAGILTGAY---AIRISSGRQAALTFVDRRIENVMA 185 Phenylobacteriu...
Q9A3A8              128 PTNLALALRLTWESADAIWRWAGDTATDENHYSKRAILSGILISTL---AVDMASGRASALSHLDARIDNVMA 197 Caulobacter vib...
WP_013269651        122 PTNADLGLSLAWESADHLWRWAGDTATDWNHYSKRTILSGILIPAL---TMRWFEGRERAEAFVRARIENVMA 191 Brevundimonas s...
Q0BXF7              114 PWGAGPALQRSWKVADMVWTAAGDTSEDYNRYSKRGLLAGVLPAIVLHWADNPSP--EDLESFIERRLAHASG 184 Hyphomonas nept...
IGS:MICA_421        113 pGRQTMAAKCVWRTADCIWDWAGDIATDYNRYTKRALLCGVLTSSTVAWLNHSGDDDAALEEFIDRRIDRIMT 185 Micavibrio aeru...
bosiu:SAR11G3_01443 103 ekkvsQILDYFFSTSSKMWSLAGDTATDINYYSKRLILSSIYSKIFIKMLNLSNYSKELIEEDIQNSLKKVKQ 175 Candidatus Pela...
WP_014954854        109 PGNILMSIKLLHENSDFIWKLSGDKSNDFSYYSKRGLLSMIYLATLIYWLNDRSNKNIATKNFISKSVDGIVd 181 alpha proteobac...
Q2GD11              108 PGNSIGSLRCSFSLSDSLWHAIGDIATGFSFYSKRATLMALNSLFMAKFADDYSDGFEKSRDFLRKRIKNIVV 180 Neorickettsia s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap