Conserved Protein Domain Family
PIG-P

?
pfam08510: PIG-P 
PIG-P
PIG-P (phosphatidylinositol N-acetylglucosaminyltransferase subunit P) is an enzyme involved in GPI anchor biosynthesis.
Statistics
?
PSSM-Id: 400695
View PSSM: pfam08510
Aligned: 138 rows
Threshold Bit Score: 89.1343
Threshold Setting Gi: 599415968
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGX43527         128 TYEYYGFVLYLTSTLAFMVYLLWSYLPAPVLHYLGIHYFYNRWWSLAVPAYIVAIILYIYVALASYNTeYMTKPFTSLEN 207 Arthrobotry...
ERN12532          54 PSEVYGFVGSITTVVATVVFLAWAYIPEPCLHFLGVTYYPNKYWALAVPAYGLVIVVSLMGFYVGLNF-MITPPPTSVST 132 Amborella t...
XP_006386533      50 SSEVYGFVGSITTVVATAIFFVWAYVPENWLQAIGIFYYPNKYWALAVPTYGMVTILLALLFYVGLNF-MSTPPPTSLNT 128 black cotto...
XP_002520426      46 TSEVYGFVGSITTIVATVIFLVWAYLPEAWLHSIGIFYYPDRYWALAIPIYAMVTVVLALLFYVGLNF-LSTPPAISLST 124 castor bean
KRH21090          46 PSEVYGFVGSITTVVATVIFLVWAYAPESWLQSVGISYYPSRYWALAVPTYVMVTIVLVLGFYIGLNF-ISTPSPASLNT 124 soybean
O64792            13 TSEVYGFVGSISIVVATVIFLIWGYVPDKFLESIGIYYYPSKYWAMAMPMYSMVTLLVALVFYIGLNF-MSTSKPTSLNT 91  thale cress
JCVI:AT2G39445.1  59 PSEVYGFVGSISTVVATVIFLVWAYVPDKLLESIGIHYYPSRYWVLAMPTYLMVTLMLALAFYIGLNF-IATPPPTSLNT 137 thale cress
XP_018514050      17 PSEVYGFVGCISTVVVTVIFLIWAYVPDKLLESIRIRYYPSRYWALATPTYLMMTLLLGLAFYIGLNF-TTTPHPTSLNT 95  field mustard
CBI17054          46 PAEVYGFVGSISTVVATVIFLVWAYVPEHWLHSIGIFYYPNRQWALAVPAYAMVTVVLALGFYIGLNF-MATPSPTSLNT 124 wine grape
XP_015167443      52 TSEVYGFVGSITTVVATVLFLVWAYLPEHWLHSLGIVYYPSRYWALAAPAYAMMTISLAVGFYIGLNF-LATPPPTSFSM 130 potato
EGX43527         208 IVDEVAkmaiveideskhrkflrgvdmqgegyessglptparsrrssssaayqqktweslddvvertmhpdggltspstc 287 Arthrobotry...
ERN12532         133 IFDEYT-------------------------------------------------------------------------- 138 Amborella t...
XP_006386533     129 IFDEFS-------------------------------------------------------------------------- 134 black cotto...
XP_002520426     125 VYDEFS-------------------------------------------------------------------------- 130 castor bean
KRH21090         125 VFDEFS-------------------------------------------------------------------------- 130 soybean
O64792            92 LFDDYS-------------------------------------------------------------------------- 97  thale cress
JCVI:AT2G39445.1 138 LFDEYS-------------------------------------------------------------------------- 143 thale cress
XP_018514050      96 LFDEYS-------------------------------------------------------------------------- 101 field mustard
CBI17054         125 MFDEYS-------------------------------------------------------------------------- 130 wine grape
XP_015167443     131 IYDEFT-------------------------------------------------------------------------- 136 potato
EGX43527         288 genhspidkvsgsmsrrkkkrkskmlfgnqvkmpKeeeyefnisnqeqadYqdeswdWKDYWSTGTDAVMDIPIGGVCEV 367 Arthrobotry...
ERN12532         139 ----------------------------------Re--------------PapmissHDG--EQPIEPISDIPLQKINDL 168 Amborella t...
XP_006386533     135 ----------------------------------Re--------------PstfipsLEG-DEQPIEPISDIGINKINDL 165 black cotto...
XP_002520426     131 ----------------------------------Rd--------------PanpvalTEGEHEQAIEPISDIGISKMNEL 162 castor bean
KRH21090         131 ----------------------------------Rd--------------PlslecsLEE-DEKPIEPISDIGIGRINDI 161 soybean
O64792            98 ----------------------------------Re--------------DvnflplMKNGEDRPIDPISDIDITRINDL 129 thale cress
JCVI:AT2G39445.1 144 ----------------------------------Re--------------PgefaagMEEGEDRPIDPISDIDITRINDL 175 thale cress
XP_018514050     102 ----------------------------------Re--------------LgefdpqMEEEDERPIDPTSDIDITSLSNq 133 field mustard
CBI17054         131 ----------------------------------Re--------------PmsfepsIG--DEQPIEPMADIGIDRINDL 160 wine grape
XP_015167443     137 ----------------------------------Re--------------PlrnvpsTDN-DEQPIEPISDIRIDQINDL 167 potato
EGX43527         368 LY 369 Arthrobotrys oligospora ATCC 24927
ERN12532         169 MF 170 Amborella trichopoda
XP_006386533     166 MF 167 black cottonwood
XP_002520426     163 MF 164 castor bean
KRH21090         162 MF 163 soybean
O64792           130 MF 131 thale cress
JCVI:AT2G39445.1 176 MF 177 thale cress
XP_018514050     134 tr 135 field mustard
CBI17054         161 MF 162 wine grape
XP_015167443     168 MF 169 potato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap