Conserved Protein Domain Family
PDEase_I_N

?
pfam08499: PDEase_I_N 
3'5'-cyclic nucleotide phosphodiesterase N-terminal
This domain is found to the N-terminus of the calcium/calmodulin-dependent 3'5'-cyclic nucleotide phosphodiesterase domain (pfam00233).
Statistics
?
PSSM-Id: 400687
View PSSM: pfam08499
Aligned: 18 rows
Threshold Bit Score: 79.6937
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009020211  33 EQDEFSRVETDAVPPEVKDWLSMTFTQsnnSTAANRKSRATRAKFRSVANCIRAGIMVDK 92  Helobdella robusta
EKC23747      46 EDDELSEVEPDAVPTEVRDWLALTFTR---SMNNVRRRGQEKPKFRSVAHAIRAGIMVDR 102 Pacific oyster
4_pfamImport   4 SEDEMSKIQWDSMPVDVQEWLTITFTS---QQEAHK--AEDAASVRTVAYAVQTGVFVER 58 
XP_014345549  47 NEDELSEIETDAVPAEVRDWLASTFTK---KMGITRRRPEEKPKFRSIVHAVQAGIFVDR 103 coelacanth
EFX77703     104 EDDDLSEVRADAVPPEVRAWLASTFTR---QISSHRKPGEEKPKFRSVAQAIRAGILVER 160 common water flea
NP_001129790  64 EDDDLAEVTPETVPDEVREWLAATFTR---QNAGKKR---DKPKFKSVANAIRTGIFFEK 117 Caenorhabditis elegans
XP_015788070 311 EEDDLSEVQPDAVPNEVREWLASTFTR---NNTAQKRRSEEKPKFRSVANAIRAGIMVDR 367 two-spotted spider mite
XP_002064872 328 EDDELSEVQPDAVPPEVREWLASTFTR---QMATSKRKSDEKPKFRSVAHAIRAGIFVDR 384 Drosophila willistoni
NP_001091918 139 EEDDLSEVTSDEVPEQVRHWLTSTFSR---Q-STKSRLGDEKPRFRSIVQALRTGLFIDR 194 purple sea urchin
CAF88636     143 lEDELGDIPSDSVPSEVRNWLASTFTR---QRALTARCSEDKPRFRSIVHVVQAGIFVDR 199 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap