Conserved Protein Domain Family
Sterol_MT_C

?
pfam08498: Sterol_MT_C 
Sterol methyltransferase C-terminal
This domain is found to the C-terminus of a methyltransferase domain (pfam08241) in fungal and plant sterol methyltransferases.
Statistics
?
PSSM-Id: 400686
View PSSM: pfam08498
Aligned: 123 rows
Threshold Bit Score: 84.7977
Threshold Setting Gi: 170941784
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EHA25398     310 YALMSKWGRIASQYLTMGLEAVRIFPKGTTAVGNSLDLAGDSLVDAGKLDIFTPMYLMLGRKP 372 Aspergillus niger ATCC 1015
XP_001690775 319 rLRMGKYTHAINHGIVSTVDALGLAPKGLKEVHHMLVEVAKSLIQGGESGIFTPMHLLLFRKP 381 Chlamydomonas reinhardtii
XP_002975480 272 RLKMGRLAYYRNHVVIALLSFLGIAPQGVFEVHEMLFKTAMYLTRGGETGIFSPMHLLVCRKP 334 Selaginella moellendorffii
XP_009398921 155 RLKMGRIAYWRNHLVVSALAALRIAPKGVVDVHEMLCETARHLSEGGETGIFTPMHIILCRKP 217 wild Malaysian banana
NP_001149131 298 RLKMGRIAYWRNSLVVRVLTMLRVAPKGVSEVHEMLYETAQHLTRGGETGIFTPMHMVLLRKP 360 Zea mays
ERM96246     292 RLKMGRVAYFRNHVVVWVLTMVRIAPKGVDDVHEMLFHTAHHLTRGGQTGIFTPMHMILLRKP 354 Amborella trichopoda
XP_002510600 292 RLKMGRIAYWRNHILVTMLSAIGIAPKGTVDVHEMLFKTADYLTRGGETGIFTPMHMILCRKP 354 castor bean
XP_006360893 292 RLQMGKIAYWRNHIVVTVLSWLGIAPKGTVDVHKMLVETADYLAKGGDKGIFSPMHMILCRKP 354 potato
CAP67438     290 VVKMSPLFLFIAESIYRVLILFGFAPPETLTLMDTMWYCCRSVAIGGKMGIFTPMYVFTCRKP 352 Podospora anserina S mat+
EEC50196     240 rFQFNWLGGHLTNVAIWCLETLWLAPRGTVKTQKVLQAGGFALRDAGNAGIFTVMYMMVGRKP 302 Phaeodactylum tricornutum CCAP 1...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap