Conserved Protein Domain Family
Ribonuc_red_2_N

?
pfam08471: Ribonuc_red_2_N 
Class II vitamin B12-dependent ribonucleotide reductase
This domain is found to the N-terminus of the ribonucleotide reductase barrel domain (pfam02867). It occurs in bacterial class II ribonucleotide reductase proteins which depend upon coenzyme B12 (deoxyadenosylcobalamine).
Statistics
?
PSSM-Id: 400666
View PSSM: pfam08471
Aligned: 60 rows
Threshold Bit Score: 120.055
Threshold Setting Gi: 293613850
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_023787225          31 DGSVVFRLEGFEVPEDWSQVAADILAQKYFRKA----GVPRHlrkieetqvpswlwrsvaderaladlpederMGGEADA 106  Hyphom...
KUCSBL:ELI_2057       41 tGATILSMEDLEFPVDYSQNACNIIASKYFRRR----GIPNG-------------------------------LGYEHSM 85   Eubact...
goetting:Awo_c19660   41 TGEIIYEMKDLEFPEHYSQNACNIIATKYFRRK----GVPNQ-------------------------------FGYEHSM 85   Acetob...
WP_013237354          42 TGKVLVDMKNLEFPENYSQNACDIIASKYFRKA----GVPGE-------------------------------NGYENSM 86   Clostr...
jgi:Clopa_3234        42 TGKILVDMKNLEFPINYSQNSCDIIASKYFRKA----GIPKA-------------------------------PHYENSL 86   Clostr...
Q97K72                42 TGKVLTDMKDLEFPYDYSQNACDIIASKYFKKS----GIPNE-------------------------------CGYENSM 86   Clostr...
jgi:Clocel_1597       36 TGKSIVDMRNLEFPVNYSQSACDIIASKYFRRS----GIPNE-------------------------------FGYENSM 80   Clostr...
Q897Z5                51 TGKVLVDMKDLEFPEHYSQNSCDIIASKYFRKA----GVPNK-------------------------------YGYENSM 95   Clostr...
jgi:Caka_0983         49 KGQAIFKQEAIEVPEAFSDLATKILSSKYFYGDidlgTDPNT-------------------------------GGRESSF 97   Corali...
Q6MNP6                36 KGEVFFEMKNVEAPEGWSQLAIDIAASKYFRKV----GVPKT--------------------------------GHETSV 79   Bdello...
WP_023787225         107 RQVFDRLAGTWTYWGWKG-GYFTSEDDAQAFFDEHRYMLARQ 147  Hyphomicrobium nitrativorans
KUCSBL:ELI_2057       86 REVADRMVGFWADALKEE-GIIETEEEWQIFYDEMVYALLKQ 126  Eubacterium callanderi
goetting:Awo_c19660   86 REIADRLVGFWADAIKEE-GLIDTDEEWQIYYDELVYAFLMQ 126  Acetobacterium woodii DSM 1030
WP_013237354          87 KSVTHRMVNFWCESLKDE-GLIKTEDESSIFYDECAYALLNQ 127  Clostridium
jgi:Clopa_3234        87 KMIAHRLVNFWCKALKDE-GLIETEEEENIFYDEMVYAFLNQ 127  Clostridium pasteurianum BC1
Q97K72                87 KMVAHRLVSFWCEALKDE-GIIKTENEASIFYDELVYALLNQ 127  Clostridium acetobutylicum
jgi:Clocel_1597       81 RQVAHRLVSFWTRALIDE-KIITTDEEKSIFYDEMVYCILAQ 121  Clostridium cellulovorans 743B
Q897Z5                96 KMVAHRMVNFWASALHEQ-GLLKTKDEKQIFYDEMVYALLSQ 136  Clostridium tetani
jgi:Caka_0983         98 KQVVDRVAGTITEWGLTD-GYFENADQAKVFGEELTWLLVNQ 138  Coraliomargarita akajimensis DSM 45221
Q6MNP6                80 RQMVDRVVKAIVASAIRQgGYFATRKEADIFAKELKFILLSQ 121  Bdellovibrio bacteriovorus HD100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap