Conserved Protein Domain Family
Herpes_TK_C
?
pfam08465: Herpes_TK_C 
Thymidine kinase from Herpesvirus C-terminal
This domain is found towards the C terminus in Herpesvirus Thymidine kinases.
Links
?
Statistics
?
PSSM-Id: 285639
Aligned: 5 rows
Threshold Bit Score: 68.2808
Created: 15-Feb-2025
Updated: 28-Apr-2025
Structure
?
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
P21293 485 PFTDDIPGLWASIYTSIRRNSAIKPNRVNWLAL 517 Herpesvirus saimiri (strain 11)
F5HB62 532 KFHDDVCGLWTEIYRQILSNPAIKPRAINWPAL 564 Human herpesvirus 8 strain GK18
O36371 514 AFRHDVPGAWGEFYMQVMKNGDIKTRVMDFTAI 546 Alcelaphine herpesvirus 1 strain C500
Q66624 572 EFIGDIPGVWTSIYTQSLRTQAIKTQSIDWSGL 604 Equid herpesvirus type 2 strain 86/87
P03177 562 EFQDDLPGCWTEIYMQALKNPAIRSQFFDWAGL 594 Epstein-Barr virus (strain B95-8)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap