1OPO


Conserved Protein Domain Family
Carmo_coat_C

?
pfam08462: Carmo_coat_C 
Click on image for an interactive view with Cn3D
Carmovirus coat protein
This domain is found to the C-terminus of the pfam00729 domain in Carmoviruses.
Statistics
?
PSSM-Id: 117039
View PSSM: pfam08462
Aligned: 8 rows
Threshold Bit Score: 198.405
Threshold Setting Gi: 81948920
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OPO_B 250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQI 329 Carnation mottle virus
Q999Y9 250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICVLVTQMEGQI 329 Carnation mottle virus
Q5ZF43 250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLVGPGISGDVDYESARPIAICELVTQMEGQI 329 Carnation mottle virus
Q4JGW6 250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTIEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQI 329 Carnation mottle virus
Q8JJU7 250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLVGPGISGDVDYESARPIAICELVTQMEGQI 329 Carnation mottle virus
Q9Q6X7 250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQM 329 Carnation mottle viru...
Q999Z1 250 QASNDKVSDGPTYVVPSVNGNELRLRVVAAGKWCIIVRGTVEGGFTKPTLVGPGISGNVDYESARPIAICELVTQMEGQM 329 Carnation mottle virus
Q7TG55 250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGRWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQI 329 Carnation mottle virus
1OPO_B 330 LKITKTSAEQPLQWVVYRM 348 Carnation mottle virus
Q999Y9 330 LKITKTSAGQPLQWVVYRM 348 Carnation mottle virus
Q5ZF43 330 LKITKTTAEQPLQWVVYRM 348 Carnation mottle virus
Q4JGW6 330 LKITKTAAEQPLQWVVYRM 348 Carnation mottle virus
Q8JJU7 330 LKIAKTSAEQPLQVVVYRM 348 Carnation mottle virus
Q9Q6X7 330 LKITKTSAEQPLKVVVYRM 348 Carnation mottle virus isolate Shanghai
Q999Z1 330 LHITKTSAEQPLQWVVYRM 348 Carnation mottle virus
Q7TG55 330 LNITKTSAEQPLQWVVYRM 348 Carnation mottle virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap