Conserved Protein Domain Family
PH_2

?
pfam08458: PH_2 
Plant pleckstrin homology-like region
This family describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function.
Statistics
?
PSSM-Id: 400659
View PSSM: pfam08458
Aligned: 44 rows
Threshold Bit Score: 90.7696
Threshold Setting Gi: 1002870393
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002457073 304 ELLKRTRQGALHWKLVSVYINSTFQVVLKMQSAHMAGTFIKTKKCVVLDVCSDIPAWAgrevEEGGshggsrSRR-GYFG 382 sorghum
XP_018674772 266 EILVATEDGKCRLRSVSAILNRDAKVVLRIKKTNALMVFSTAKESVVYELD-----------TNPLeepkkeADGsYCIG 334 wild Malaysian ...
XP_014751107 283 eMFVAMPDGKWKLHTVSAASNKDGKVVLRIKKMNLVMAFSNAKESVVNDMS-----------PCAPekasrdEEAtYPME 351 stiff brome
CAH67518     277 eMFVAMPDGKWKLHTVSAATSKGGKVVMRIKKMNLVMAFSNAKESVIHDVQ-----------PCAPekpsrdEDAtYPIE 345 rice
AQK44539     312 eMFVAMPDGKWKLHTVSAASNKRGEIVLRIKKTNLVMAFSHAKESVIHDVQ-----------PCSPekpsphEGAtYPVE 380 Zea mays
CAN67054     277 qLTIHTSDGRCLLRSVSIILNSQAKVILKIRKLNLMNTFSSKKESIIQDLHAELY-------DDSEade---tnTcYLIV 346 wine grape
EFH42487     293 DLFVETPDGDFKARTVSMVLNKDGKVILKMKKHN---LLRTKKESIVTNVHVELY-------KDSDsednniEDTcYLIV 362 Arabidopsis lyr...
XP_009126814 294 DLFVETPDGDFKVRTVSMILNKDAKVILKMKKHN---LLRTKKECIVTNVHVELY-------KDSEteennmEDTcYLIV 363 field mustard
EEF28395     245 ELHVETPDGNFGVRSVSIVLNSQAKVILKIRKLN---LLKSKKESIVLDLHTELY-------KDSEgdq-etDTTcYLIV 313 castor bean
ERN07162     285 qLIVHNTNGKCKPRFISIVLNNQAKLVLKIRKNNMLKSLMHATESIIDKFTGFISNMH----SSLQedsaeeDDRpYLIV 360 Amborella trich...
XP_002457073 383 IRTVERVIEFE-CRSRHEQRKWVQGITEMLLRR 414 sorghum
XP_018674772 335 MQTSQGKIELK-TDDYVQCKKWLTTINHMLMLS 366 wild Malaysian banana
XP_014751107 352 VSTSKGKVELR-ADDYAVYKRWVTTVTHMLASS 383 stiff brome
CAH67518     346 VTTSKGKVELR-ADDYGVYKRWVTALTHMLAAp 377 rice
AQK44539     381 VSTNKGKVELR-TDDYGVYKRWVATLSHMLVMS 412 Zea mays
CAN67054     347 LTTNHGTIKLDmGDDYHLYKIWATTVNHMLTLS 379 wine grape
EFH42487     363 LRTNRGAIKLDmADDYSRYKTWVTTIQHMLTLS 395 Arabidopsis lyrata subsp. lyrata
XP_009126814 364 LKTNIGAIKIDmADDYARYKTWVTTVQHMLALs 396 field mustard
EEF28395     314 LTTNEGIIKLDmGDDCHRYKTWATAIHHMLMLs 346 castor bean
ERN07162     361 LETTEGIIKLE-MNESVSYKIWSMTINYMLLls 392 Amborella trichopoda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap