6C6Q,3ASP,4RLZ,3PUN


Conserved Protein Domain Family
Calici_coat_C

?
pfam08435: Calici_coat_C 
Click on image for an interactive view with Cn3D
Calicivirus coat protein C-terminal
This is the calicivirus coat protein (pfam00915) C-terminal region.
Statistics
?
PSSM-Id: 400645
View PSSM: pfam08435
Aligned: 29 rows
Threshold Bit Score: 316.496
Threshold Setting Gi: 81962581
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6C6Q_A  81 LIEQDGSAYVPGDRAAPLGYPDFSGQL-EIEVQ-TETTktgdkLKVTTFEMILGPTTNADQAPYQGRVFASVTAaa--sL 156 Murine norovirus 1
Q9IV42 305 LSEVDGTPFIPLESPAPVGFPDLGSCDwHVNFTfQAQN-------QDPSQSVTFATNDASFVPYLGSISLTTGEtf-haG 376 Human calicivirus HU/...
Q83876 301 LTELDGTPFHPFEGPAPIGFPDLGGCDwHINMTq---------FGHSSQTQYDVDTTPDTSVPHLGSIQANGIGs----G 367 Norwalk virus
3ASP_A  89 LTEVDGKPFMAFDSPAPVGFPDFGKCDwHMRIS-KTPNn---tSSGDPMRSVSVQTNVQGFVPHLGSIQFDEVFnh-ptG 163 Norwalk-like virus
Q91I85 304 LTELDGSPFMAFAAPAPAGFPDLGSCDwHIEMS-KIPNs---sTQSNPIVVNSVKPNSQQFVPHLSSITLDDNVss--gG 377 Human calicivirus HU/...
Q9IV43 304 LTELDGSPFLAFEAPAPTGFPDLGTSDwHIEMS-LNSNs---qSSGNPILLRDIQPNSSDFVPHLGSVSVTTAIdt--aG 377 Human calicivirus HU/...
Q8JXJ0 304 LTELDGSPFLAFEAPAPAGFPDLGKCDwHVEMSlYQDN-----NHADPIVLHAIEPNSSSFVPHLGSVSFKENVnv--aG 376 Norwalk-like virus
Q8VA02 306 LTELDGSPYHAFESPAPVGFPDLGECDwHMEAS-PTTQ-----FNTGDVIKQINVKQESAFAPHLGTIQADGLSdvsvnT 379 Human calicivirus NLV...
Q66418 306 LTELDGSAYHAFESPAPIGFPDIGDCDwHMSAT-ATNN-----FTGSSNEYQILIKQESAFAPHLGHVQADNLSag-anT 378 Desert Shield virus
Q6B7R2 304 LSELDGSPYHAFESPAPVGFPDLGHCDwHVSSF-KADQ-----NSSGDPISRLDIKQGASFAPHLGSIEYTTSQnp--dG 375 Norovirus NLV/IF2036/...
6C6Q_A 157 D-LVDGRVRAVPRSIYGFQD-----TIPEYNDGL--LVPLAPPIGPFLPGEVLLRFRTYMRQIdTAdAAAEAIDCALPQE 228 Murine norovirus 1
Q9IV42 377 DiIGSLGWISSPRLIIHNSMf---gTIPKYGSSLpdVTHLAPAVFPPGFGEVILYFYSIFPGS-GQ-PSQLQVPCLLPQE 451 Human calicivirus HU/...
Q83876 368 NyIGVLSWVSPPSHPSGSqvd--lwKIPNYGSSIteATHLAPSVYSPGFGEVLVFFMSKIPGP-GG----DSLPCLLPQG 440 Norwalk virus
3ASP_A 164 DyIGTIEWISQPSTPPGTdin--lwEIPDYGSSLsqAANLAPPVFPPGFGEALVYFVSAFPGPnNR-SAPNDVPCLLPQE 240 Norwalk-like virus
Q91I85 378 DyIGTIQWTSPPSDSGGAntn--fwKIPDYGSSLaeASQLAPAVYPPGFNEVIVYFMASIPGPnQS-GSPNLVPCLLPQE 454 Human calicivirus HU/...
Q9IV43 378 DtLGTIQWTSQPSNVTPVPdvn-fwTIPQYGSSLaeASQLAPVVYPPGFGEAIVYFMSPIPGPnTA-HKPNLVPCLLPQE 455 Human calicivirus HU/...
Q8JXJ0 377 DyVCTIQYTSPPSDPHNPNAdvdfwSIPDYGSNLaeASQLAPVVYPPGFGEAIVYFMSRVPGWnRT-NRLNLVPCLLPQE 455 Norwalk-like virus
Q8VA02 380 NmIAKLGWVSPVSDGHKGdvd--pwVIPRYGSTLteAAQLAPPIYPPGFGEAIVFFMSDFPIA-HG-TNGLSVPCTIPQE 455 Human calicivirus NLV...
Q66418 379 DlIVSLSWISPVSDQHRHdvd--pwVIPRYGSSLteAAQLAPPIYPPGFGEAIVFFMSDFPVV-SG-VNGMRIPCTLPQE 454 Desert Shield virus
Q6B7R2 376 GqLGTLTWISSPSDDTPGHGtinlwKIPSYGSTVteSVHLAPPIYPPGFGETLVNLMSNFPIGhTN-SNMAQVPCTLPQE 454 Norovirus NLV/IF2036/...
6C6Q_A 229 FVSWFASNAFTVQSEALLLRYRNTLTGQLLFECKLYNEGYIAL--SYSGSGPLTFPTDGIFEVVSWVPRLYQLASVG 303 Murine norovirus 1
Q9IV42 452 FITHFCNEQAPIAGEAALLHYVDPDTGRNLGEFKLYPDGFMTCvpNSVSSGPQTLPINGXFVFVSWVSRFYQLKPVG 528 Human calicivirus HU/NLV...
Q83876 441 YISHLASEQAPTVGEGPLLHYVDPDTDRNLGEFKAYPDGFLTCvpNGASSGPQQLPINGVFVFVSWVSRFYQLKPVG 517 Norwalk virus
3ASP_A 241 YITHFVSEQAPTMGDAALLHYVDPDTNRNLGEFKLYPGGYLTCvpNGVGAGPQQLPLNGVFLFVSWVSRFYQLKPVG 317 Norwalk-like virus
Q91I85 455 YITHFISEQAPIQGEAALLHYVDPDTNRNLGEFKLYPGGYLTCvpNSSSTGPQQLPLDGVFVFASWVSRFYQLKPVG 531 Human calicivirus HU/NLV...
Q9IV43 456 FVTHFVSEQAPSMGEAALVHYVDPDTNRNLGEFKLYPEGFITC--VPNGTGPQQLPLNGVFVFASWVSRFYQLKPVG 530 Human calicivirus HU/NLV...
Q8JXJ0 456 FIGHFVSEQAPAIGEAALLHYVDPDTNRNLGEFKLYPEGFITC--VPNGTGPQQLPLNGVFVFSSWVSRFYQLKPVG 530 Norwalk-like virus
Q8VA02 456 FVTHFVNEQAPTRGEAALLHYLDPDTHRNLGEFKLYPDGFMTCvpNSSGTGPQTLPINGVFVFVSWVSRFYQLKPVG 532 Human calicivirus NLV/Po...
Q66418 455 YVAHFVNEQAPTRGEAALLHYVDPDTHRNLGEFKMYPEGFMTCvpNSSGSGPQTLPINGVFTFVSWVSRFYQLKPVG 531 Desert Shield virus
Q6B7R2 455 FVAHFVNEQAPVRGDAALLHYVDPDTHRNLGEFKLYPEGYITCvpNTGGGGPQSLPTNGVFIFSSWVSRYYQLEPVG 531 Norovirus NLV/IF2036/200...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap