Conserved Protein Domain Family
CLCA

?
pfam08434: CLCA 
Calcium-activated chloride channel N terminal
The CLCA family of calcium-activated chloride channels has been identified in many epithelial and endothelial cell types as well as in smooth muscle cells and has four or five putative transmembrane regions. Additionally to their role as chloride channels some CLCA proteins function as adhesion molecules and may also have roles as tumor suppressors. This protein cleaves itself into an N-terminal portion and a C-terminal portion. The N-terminus contains an HEXXHXXXGXXDE motif which is essential for proteolytic cleavage.
Statistics
?
PSSM-Id: 400644
View PSSM: pfam08434
Aligned: 25 rows
Threshold Bit Score: 469.108
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3SYU0         24 VRLNNNGYEGIIIAIDPAVPEDETLIEKIQNMVIDASTYLFEATEKRFFFKNVSILIPENWKSITQYKRPKHESYKHADV 103  cattle
XP_007667306   25 IELKNNGYEGIVIAINPQIPEDEKIIQQIQDMVTEASTYLFQATKKMVYFKSVAILIPETWQDKPEYLISKRESYQTADV 104  platypus
XP_016284979   24 IQLNGNGYDGIVIAINPSVLEDEKLIQKTKEMVTEASTVLFHATNKRAYFRNVSILIPMTWTSKPEYLIPKLESYEQADV 103  gray short-ta...
XP_024840409   32 VNLINNGYDGIVIAINPSVPEDEKLIENIKEMVTEASTYLFHATKRRVYFRNVSILIPMTWKSKSEYFIPKQESYDQADV 111  cattle
XP_006634877   21 IELDGNGFTNILVAINPAVPENPQLIQNIKDMINSSSAYLVTATQKMFYFKDVKILVPPNWAPQPSYTRGKTESYENANV 100  spotted gar
XP_422360      31 VKLNESGYEDLVVAINPSVTEDANIILNTKAMIKDASNYLFEATKHRFFFKSVKIILPKTWKKNSTYSRLKTESYNKADV 110  chicken
XP_008107509   23 VTLNNGGFENVIIAINPGIPEDDKIIDSIKDMVKDASSYLFSATEQRFYFKSVKIIIPLTWTPKPEYKRVTTESYDKADI 102  green anole
XP_007480625   24 IKLNGNGYEDVVIAIDPNVPEDEKLIQQIEDMISEASTYLYRATEKRFYFESVSILIPKTWQPKSDYEKPKHETYKNADI 103  gray short-ta...
XP_001362488   24 IKLNGNGYEDVVIAIDPNVPEDEKLIQHIQDMVTEASTYLYGATEKRFYFKAVSILIPETWQKKNEYEEPKLETYKKADI 103  gray short-ta...
XP_016848480   23 VKLRNGGYEDVVIGIDPKIAENVKIINSIKEMFKEASSFLFHASQQRFYFRTIKIVIPSTWASKPEYGRVSRESYENADI 102  green anole
Q3SYU0        104 RVAPPTLPGRDEPYTKQFTACEEKGEYIHFTPDFVLGNKQ-NEFGPSGRLLVHEWAHLRWGVFDEYNDDEPFYRAKSRKI 182  cattle
XP_007667306  105 IVAEPSPAHIDTPYTKQTGLCGEPGQYIHFTPKFLAGDLL-REHGPLGRVFVHEWAHFRWGVFDEYDDKQPFYISSDGHL 183  platypus
XP_016284979  104 IVADPYLKYGNDPYTLQYGQCGEKGRYIHFTPNFLLGDNL-NIYGPRGKVFVHEWAHLRWGVFDEYNLDQPFYITRQNTI 182  gray short-ta...
XP_024840409  112 IVANPYLKYGDDPYTLQYGRCGEKGKYIHFTPNFLLTNNF-HIYGSRGRVFVHEWAHLRWGIFDEYNVDQPFYISRKNTI 190  cattle
XP_006634877  101 VIKD--MSYGDDPYTLQYDECGKPGKYIHLTPSFLLNDSLlNAYGPRGRVFVHEWAHLRWGVYDEYNEDTPFYISSSQQV 178  spotted gar
XP_422360     111 IIADPYLKYGDDPYTLQYGGCAMKGRYIHFTPNFLLDSSMiKVYGERGRVFVHEWAHLRWGVFDEYNNDAPFYVSENARV 190  chicken
XP_008107509  103 IVADPFLKYGDDPYTLQYGGCGEPGRYIHLTSNFLTNDSMhDVYGPRGRVLVHEWAHLRWGVFDEYNNDAPFYTTGVNQA 182  green anole
XP_007480625  104 IIEVPNSPGNDIPRIDQFGKCGERGERIYLTPRIIRGEML-NVFGPKGKVLVHEWAHFRWGVFEEYNEDNPFYQFDGKN- 181  gray short-ta...
XP_001362488  104 VIEVPNPPGFDVPRTDQFGQCGDKGERIRLTPAIVLGEKL-NEYGPQGKILVHEWAHLRWGVFEEYNEEEPFYQHDGRN- 181  gray short-ta...
XP_016848480  103 IVAEPFVKYGNDPYTLQYGGCGKKGRYIHFTSNFLIDESLvYIYGPRGRVLVHEWAHLRWGVFDEYSNDAPFYSTGANKS 182  green anole
Q3SYU0        183 EATR----------------CSTSITGLNRVYM-CEGGSCVTnREC---------------------------------- 211  cattle
XP_007667306  184 EATR----------------CSSEIEGKFMMQK-CQGGSCIT-KLC---------------------------------- 211  platypus
XP_016284979  183 EATR----------------CSRNIAGVNRVLK-CSNKSCAI-KMC---------------------------------- 210  gray short-ta...
XP_024840409  191 EATR----------------CSTHITGINVVFKkCPGGSCIT-SLC---------------------------------- 219  cattle
XP_006634877  179 EATR----------------CSKDLTGSLGVPSsSDSSL----QRC---------------------------------- 204  spotted gar
XP_422360     191 EPTR----------------CSAGVTGKP-VFRnCNGNQCTT-REC---------------------------------- 218  chicken
XP_008107509  183 EATR----------------CSAGITGQY-IFRsNTGAA----RKC---------------------------------- 207  green anole
XP_007480625  182 VPVK----------------CSEGITGTNKVYT-CSGGSCSI-RDC---------------------------------- 209  gray short-ta...
XP_001362488  182 VPVK----------------CSDGITGTNKVYA-CSGGSCSI-RNC---------------------------------- 209  gray short-ta...
XP_016848480  183 EATRyhtksvvfkevamivpCIKKNEGRGR----MKCGSTFI-SNCffifvrafvnkdplslfkgcnrgpgcffrcaagi 257  green anole
Q3SYU0        212 ----------------RIDSKTKLYEKNCQFFPDKDQTEKTSIMFMQGIDSVTEFCNEKSHNQEAPTLQNKMCNYRSTWE 275  cattle
XP_007667306  212 ----------------KIVPQTGLLEEGCTFIPNEFQSVTSSLMYMQSLESVTEFCNKENHNAEAPNQQNRMCELRSTWD 275  platypus
XP_016284979  211 ----------------KTNRKTGMYEAKCQFIPEKSQSAKASIMFMQSLDSVVEFCTKKTHNPDAPNLQNKMCNHRSTWE 274  gray short-ta...
XP_024840409  220 ----------------RRDSQTGLYEAKCTFLPKKSQTAKESIMFMPSLHSVTEFCTEKTHNTEAPNLQNKMCNGKSTWD 283  cattle
XP_006634877  205 ----------------SKDQITGLPSANCQFFPDKTQKTSASIMYLQSLPAITEFCNDKSHNQEAPNMQNRMCNYRSVWS 268  spotted gar
XP_422360     219 ----------------QYDGQ--LYEAGCVFVPDLNQNSKNSIMYMQSLPSVVEFCDKNTHNSEAPNMQNKMCNYKSTWE 280  chicken
XP_008107509  208 ----------------KFEYRTQLYEPGCQFIPDKKQTASASIMYMQSLSSAMQFCNKSNHNIKATNMQNKQCNFRSTWE 271  green anole
XP_007480625  210 ----------------WTDPKTGKLNKDCMFIPDKVQSEKASIMFMQSIDSVVEFCTEKNHNRFAPNLQNKMCYLKSTWE 273  gray short-ta...
XP_001362488  210 ----------------RTDPKTGKLNKDCMFIPDKVQSEKASIMFMQSIDSVVEFCTEKNHNTLAPNPQNKMCNSRSTWE 273  gray short-ta...
XP_016848480  258 tgqyrfqtgtaetrncRIQRQTELYEPGCLFIPHIKQTSPVSIMFMQSLPSVSQFCDKSNHNLMAPNMQNKMCSYKSTWE 337  green anole
Q3SYU0        276 VISNSEDFKNTTAML 290  cattle
XP_007667306  276 VIQGSADFNNTKPMT 290  platypus
XP_016284979  275 VIMASEDFRNLSSMR 289  gray short-tailed opossum
XP_024840409  284 VIMNSVDFQNTSPMT 298  cattle
XP_006634877  269 VIGSAPDFDRTAPMT 283  spotted gar
XP_422360     281 IIMESDDFRNSSVVN 295  chicken
XP_008107509  272 VIMNSSDYASSFPIN 286  green anole
XP_007480625  274 VIQDSEDYKKSTPMM 288  gray short-tailed opossum
XP_001362488  274 VIQNSEDYKNSIPMT 288  gray short-tailed opossum
XP_016848480  338 VIMNSADFVSSRALG 352  green anole
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap