Conserved Protein Domain Family
DUF1741

?
pfam08427: DUF1741 
Domain of unknown function (DUF1741)
This is a eukaryotic domain of unknown function.
Statistics
?
PSSM-Id: 400639
View PSSM: pfam08427
Aligned: 66 rows
Threshold Bit Score: 209.335
Threshold Setting Gi: 284094535
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_010757008  406 RILATVIFDIMIDTINHNLRRGLDVNLYCHTISILLRLLTYVSSNKTRLTYHWSELWRTLATLTRFLAT----YSTDLLS 481  Paracoccidioi...
CDS35750      461 NTMAAVLLDLLVEFFCTHLMKSFPFEIHGQCLNICYHLLSHQKEHGLRLNYDWRQLWKALFDLMRYVIK----PDGPCVC 536  Echinococcus ...
XP_001952575  430 KPLAAALLDLMIEFMLGHMMKKLPLDQYMKCISIIHRIICYQKRNSVRLCYNWKDLWSSLITLLKFLMT----YEHQLSQ 505  pea aphid
XP_002070278  429 QPLAATLLDLLVEFIVSHLMKKFPMELYLLCIGVIHRILCYQKRCRVRLNYPWKELWSALIGLLRFLVN----QEQTLVK 504  Drosophila wi...
Q16NY2        429 QPLAATLLDLLVEFIVSHFMKKFPMELYLLCTGIIHRVIVYQKRCRVRLIYPWKELWTALISLLKFIVY----QEQTLVK 504  yellow fever ...
XP_008210355  417 QPLAATLLDLIVEFIMSHMMKKFPLELYHHCIGILLRILCYQKRCRVRLNYQWIHLWTVLMNLLKFITT----HESSLAK 492  jewel wasp
EFN83594      423 QPLAATLLDLLVEFITSHMMKKFPLELYHQCIGVLQRLLCYQKRCRVRLGYQWRDLWTALINLLKFLTT----HESHLIK 498  Jerdon's jump...
EDQ91406       95 GAMAKMIFDVAIELLMSHMKKSLNVEQFGLTLQIIHRLLCFEKHSRVRLNFKWQQLWNALAALLRFIVA----HASTLEE 170  Monosiga brev...
EGG17293      583 HPITTYVINILNQFMKCNLKAK-NGDIQHKIISCIQRVVSYKKKTQARLPIKWNETWLSLFSFITSIMT----SEKNLLS 657  Cavenderia fa...
Q551U4        728 HPLSCWTLDILSQFIKCNLKGKISMDVHQSAVDCIHRIVSYKKKTLNRLPYKWSELWSALFSLISMVSTlnisNDKIQLN 807  Dictyostelium...
XP_010757008  482 NPQTHNLAASLIDLIVFCISAGDTFLPDPASYDDLFYKVVETGPiltRFKEIYKPSFSPSaptstpp------------- 548  Paracoccidioi...
CDS35750      537 -GETFTTLLKIVGIFNFFITFGDCFLPDPNTYDDLYYELIRMKD---VVERLIKFVDQHSc------------------- 593  Echinococcus ...
XP_001952575  506 DMNIYDLGIQIVNIFNLFITYGDMLLPSPSSYDELYYEIIRMHT---VFDNIYVLSSRNS-------------------- 562  pea aphid
XP_002070278  505 KCNIFHLSLQVVNIFNLFITYGDTFLATTNSYDELYYELNREEK---VFTEIHAMVLRYTt------------------- 562  Drosophila wi...
Q16NY2        505 KCNIFHLAIQVVNIFNLFITYGDTFLATTSSYDELYYELNREEK---VFSEIHAMVLRYTt------------------- 562  yellow fever ...
XP_008210355  493 KMNIFSLATKVVNILNIFITYGDMFLLSPNTYDELFYEIIRMKF---IFINLNAMGLRYSn------------------- 550  jewel wasp
EFN83594      499 KMNIFPLAIQVVNILNLFITYGDTFLSSPSSYDELFYEIIRMRL---IFTNLNAMALRYSt------------------- 556  Jerdon's jump...
EDQ91406      171 QFDVYDLARQVVVIYNLFVTYGDTFLPDPDSYDQLYYELIRERN---AFDTLFELAKRHS-------------------- 227  Monosiga brev...
EGG17293      658 --DLIPIGIEAINLFNLFINYGDLFLPQPSDYDDLFYELIRGSK---VIEEFSKLV------------------------ 708  Cavenderia fa...
Q551U4        808 --QSIHVGISTVNIFNLFINYGDSFLPSPNDYDELFYEIIRSGQ---VIENFYQFILNQTttggqsvtspsaaasasnpt 882  Dictyostelium...
XP_010757008  549 ----------kttgakvPSIPTPTPTPSSAALSIDTLISVASHFHSLLfldDTDKKTSpapttttpttttdpaaaaeilt 618  Paracoccidioi...
CDS35750      594 -----------------SPKSDWKSSARDLRESAQNLKVIVKHFNDKI---SAYIAKS---------------------- 631  Echinococcus ...
XP_001952575  563 -----------------SSVSEHKLSATKLSNCLINIRAIINHYIPKI---DNWLEKN---------------------- 600  pea aphid
XP_002070278  563 -----------------MPECEYKDDVIKLLNALVNILAIVKHFQNKI---KEWLAEQ---------------------- 600  Drosophila wi...
Q16NY2        563 -----------------IEECEYKEDVFKLLNSMVNILAIIKHFQIKI---KEWLSAE---------------------- 600  yellow fever ...
XP_008210355  551 -----------------NDTYEYKESAAKLINALVNMRDILNHFPPKI---SEWLSKE---------------------- 588  jewel wasp
EFN83594      557 -----------------SESYEHKEHALKLTNSLVNVRDIVNHFPPKI---TAWLTKE---------------------- 594  Jerdon's jump...
EDQ91406      228 -----------------RTAGTYATAAGRLATSLINIRAIIGHFAPKI---DAWSQLH---------------------- 265  Monosiga brev...
EGG17293      709 ---------------------EVEDPTGNMTNSLLNIKSIIAHFSTHI---QTWNNEH---------------------- 742  Cavenderia fa...
Q551U4        883 tptplspqqlptittttTTITSNNESNNPLLNQLLNIRSIVQHFTSKL---EEWSANN---------------------- 937  Dictyostelium...
XP_010757008  619 mgKKKNLSPREVHQIIKQGYDTLSIRS-QEGLNLWEKWRESD--W----KSELKRIARCAVEDARV 677  Paracoccidioides brasiliens...
CDS35750      632 --SITSLTEAQVFEIIQNNYESLTLRv-SKDLNKY--YDEAAgdV----EEDNDRMLVEVVQNVRR 688  Echinococcus multilocularis
XP_001952575  601 --SVTTPVGEEILEVVRNNYDTLTLKLlLDCLGSFE---SNKsnHdlssSSLIKLMVSKVVKDTRQ 661  pea aphid
XP_002070278  601 --GLSTPTEDQILDVVRKNYD-LTLKl-QDSLDQYERY-AEAplH----TNFFKTMVRDVVNDTRK 657  Drosophila willistoni
Q16NY2        601 --SLSTPTEEQILAQIQKNYD-LTLKl-QDSLEFFERY-TEKp-H----DLFFRNLVKDVVIDTRK 656  yellow fever mosquito
XP_008210355  589 --NISTPTEKQIMDIIIQNYDSLTLKl-QDNLDQFDRY-SENtsH----LKFFDSLVKSIIYTTRT 646  jewel wasp
EFN83594      595 --SLSTPTEQQILAIIIQNYDSLTLKl-QDNLDQYERY-SEKpnH----TAFFEEMVSGVVVDTRA 652  Jerdon's jumping ant
EDQ91406      266 --SGAPPSPENVLTVVRENYDTLTLKl-QDGLDTYAPY-HEApeA----QKRLVQICRSMLHHqpt 323  Monosiga brevicollis MX1
EGG17293      743 --PEEPLTSDMVIAIIKDNYETLRLKl-AENLDVYEKY-VENsnE----AVFYRHYIRFLILDTKK 800  Cavenderia fasciculata
Q551U4        938 --AEVALTAPQVSKIIKDNYDTLRLKl-QENLDQFEPY-VENpkE----VLFFKHIIKELINDLRK 995  Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap