Conserved Protein Domain Family
Pol_alpha_B_N

?
pfam08418: Pol_alpha_B_N 
DNA polymerase alpha subunit B N-terminal
This is the eukaryotic DNA polymerase alpha subunit B N-terminal domain which is involved in complex formation. Also see pfam04058.
Statistics
?
PSSM-Id: 400634
View PSSM: pfam08418
Aligned: 80 rows
Threshold Bit Score: 124.353
Threshold Setting Gi: 348514227
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCD22692        15 PEILTILENLSKIHAISAEDLYIKWEQFSI-GKNETHTeYSLRN-----LDQFKQFLQQQVEKHAksisspiiknksnnp 88  Naumovozyma d...
Q6C5E1          15 EELKKECANIMSIFNLSEEDLFIKWECFAInTNGDEKTdLDLGN-----LSKLKTYLLKEIEK----------------- 72  Yarrowia lipo...
Q6CVG1          18 AEVISTLQHYMKIYDLSVDEIYIKWEQFSY-HNKDk---YAVNSysdqiLQEFKDYIQQQMEKKVntsiv-----lnpsi 88  Kluyveromyces...
ybcl:Ecym_7448  18 VKIIGILESYMKLYALSVDELYIRWEQFSY-HNQHLSLkLDEST-----LQNFKLFIQQQIEKKGnishgsvnspgasns 91  Eremothecium ...
Q75B71          18 ETVVTTLESYMKLYALSIDELYIKWEQFAY-HSLDGGVkLDANG-----LDNFKGFIQRQIEK-Anmaqgnaadvshgag 90  Eremothecium ...
XP_006689622    24 NGVISKIHTLKNIFNLSTEDIFLQWETYNV-SEVKENLeLSLIV-----LDGFQEYLQRHLAD-Asnktp-----svkrl 91  Yamadazyma te...
CCE86555        34 DEVLRKLASLAEIFHTNANDLFVHWETFNV-TKVQDDLeLTVIN-----LDKFHEYLQESLANkgtps--------mrgs 99  Millerozyma f...
Q6BK10          23 DDVIEKLSTLMQIFNLSSEDLFVHWESFNV-TKVQNDLdLTLPN-----LDLFQEHLQSTLVNASskatp-----sirkv 91  Debaryomyces ...
XP_001385361    26 EDVCKELGTLMSLYQLSSDDLYIKWESFNV-AEVQENLdLTIEN-----IDRFQKYLQSSLSTsratp-------takra 92  Scheffersomyc...
XP_002549858    23 DEEYEKIQWLSDTYEKSIEDLFLEWESFNV-TEVQQDLdLNLDS-----LNQLQSYLQTKLSKnqtps--------fkki 88  Candida tropi...
CCD22692        89 Sss---lKKPRSLRPL-----NASP---------------MFGIPLNS-S---PRTPLLKKRKLA--------------- 126 Naumovozyma d...
Q6C5E1          73 ---------AKKAK-------TTTPrpkmrrnregagdmdLFDQLTHSaLgsaKRGPAGgd------------------- 117 Yarrowia lipo...
Q6CVG1          89 Nss---iKKPKMLIPS-----TNSPs--------------IFGLG----I---PNTPTLKKRRLeagt------------ 127 Kluyveromyces...
ybcl:Ecym_7448  92 GrnpnlgKKPKMLRP------TGGTg--------------LFGFGGS------PNTPVVKKRKLEdrsflknelqadgss 145 Eremothecium ...
Q75B71          91 Hgs--gaKLPRPLRA------TGGSs--------------LFGYGSS------PRSSNVRKMKLDvlhsdrdspgppssp 142 Eremothecium ...
XP_006689622    92 RdsvgstIKRRPLKPLn----SSSPi-----------------------AesnFHTPSLKMRKVN--------------- 129 Yamadazyma te...
CCE86555       100 Kdvs-sgtVKKPLLRPsiaisSSSPs-----------------------Sg-fPATPSLKRRKVP--------------- 139 Millerozyma f...
Q6BK10          92 KdlqsstMRRKPIIRSsadinSSSP------------------------AnaiPSTPSLKKRKVVe-------------- 133 Debaryomyces ...
XP_001385361    93 RdiqgsnIKKKPIIRSnadfnSSSPv--------------------------iPSTPNLKKRKVIe-------------- 132 Scheffersomyc...
XP_002549858    89 KdgitlgGSNKKLKRNnnelsSGGH------------------------I---PSTPYLKRKKLDdelgs---------n 132 Candida tropi...
CCD22692       127 ---SANQTNlngnTPNGAKLefNNGNDSNSdiKMEQEQGSERPpaSdiidnetstvsvkseitfdsaNTSAINNMSNVki 203 Naumovozyma d...
Q6C5E1         118 -ndQTPVKKrpqpNGTGNGLs-MSPPLSVT--PIRSTPPPPSN--------------------------SAYSSRKGA-- 165 Yarrowia lipo...
Q6CVG1         128 pteASKVSP----SAANSTSilNTSP-SVT--TPTTATPANLKnaS------------------------------EP-- 168 Kluyveromyces...
ybcl:Ecym_7448 146 pivDTRSSPifngENSSAGTpySMKETAFP-------------------------------------------------- 175 Eremothecium ...
Q75B71         143 vghTSVFSD----AGPGFGTptSAGDSRDT-------------------------------------------------- 168 Eremothecium ...
XP_006689622   130 ---GTPF------KTPGAGPd-SSPS-NFE--TANNTFRN-----------------------------SPVRSSELS-- 165 Yamadazyma te...
CCE86555       140 ---EGSAFK----TPRT-GLe-SSPV-DYI--SANNTFHSPSSntNysd----------------diQSSPTKTQQNE-- 189 Millerozyma f...
Q6BK10         134 ---ETPAFK----TPQLKME--SSPI-NYA--TANNTFQSPIP-------------------------EVNNNLQSSPtp 176 Debaryomyces ...
XP_001385361   133 --eATPAFK----TPRADFNa-SSPA-DFN--TANNTFQSPST--------------------------PNVSKKQES-- 174 Scheffersomyc...
XP_002549858   133 glnTTPDFK----TPMAYGVtsSPGATDFE--TANNTFAGNNNa------------------------------------ 170 Candida tropi...
CCD22692       204 epg----edtfGKILDSLNp-----ENMDVSTGlnlnilkglesnsdknreNKVKIAPFYDPQKYKFRTMRQNLIDASDV 274 Naumovozyma d...
Q6C5E1         166 -----------GTVMETLN------SSIELNPGrad-------------peTKIAISDHVQSAKYKYKTMYQKVSEASET 215 Yarrowia lipo...
Q6CVG1         169 -----------DKCLVTLNv-----DNVAKAEGidf------------dndSKVKISPFYDPKKYKFRTMRQSLLDTADV 220 Kluyveromyces...
ybcl:Ecym_7448 176 -----------DKIIDTLNp------DLPIGEGidf------------nneSKVKMVPLYDQKKYKYRTMRQNLLDSADV 226 Eremothecium ...
Q75B71         169 -----------DKIVDTLNp------DLPIADGadf------------dsdHQVRSIPFYDTKKYKYRTMRQRLLGAADV 219 Eremothecium ...
XP_006689622   166 -----------NTILETLNghidsvENGQTNEK------------------GKIQIASNFDPQKYKFRSMAMKLLESADF 216 Yamadazyma te...
CCE86555       190 -----------GLPIEVLNp-----Dlpeltleg----------etsddasKPFSISLNFDPSKYKFRTMSMKLLESADV 243 Millerozyma f...
Q6BK10         177 lfnkllkneesNTVIETLNp-----Dieelpgymq-------ldedpstaiKPYRLASNFDASKFKYRTMSMKLLESADV 244 Debaryomyces ...
XP_001385361   175 -----------NTIIETLNp-----Eidvlpgfvq-------ldedpatslKPYKLMYNFDASKFKYRTMSMKLLESADV 231 Scheffersomyc...
XP_002549858   171 ----------sNSLLETLNp-----Eideien-------------delpedRPFKLATNFDSTKFKFRTMQMKLLESADV 222 Candida tropi...
CCD22692       275 LDEQIEIFTKIIQEHYNLSP-NQFSDPTIQS 304 Naumovozyma dairenensis CBS 421
Q6C5E1         216 LDEQIEQYMDWCVQKGLVKSnAEFKNPSLSD 246 Yarrowia lipolytica
Q6CVG1         221 LDEQIDIFSEIIQKHYNLKP-SDIGDPTFQQ 250 Kluyveromyces lactis
ybcl:Ecym_7448 227 LDEQINIFTDIIQERYNLGN-SDLGDPTIQS 256 Eremothecium cymbalariae DBVPG#7215
Q75B71         220 LDEQIEHFTSVVQKDLGISS-AELGDPTIQS 249 Eremothecium gossypii
XP_006689622   217 LDDQIDNFAQLFQDAHKGED-LNFGNPCLSS 246 Yamadazyma tenuis ATCC 10573
CCE86555       244 LDDQIDTMASIISENKK--D-IELNNPCLSS 271 Millerozyma farinosa CBS 7064
Q6BK10         245 LDDQIDSMTQLFQENQESTD-LQFGNPCLCS 274 Debaryomyces hansenii
XP_001385361   232 LDDQIDSFTQLYIDNHKEDG-NLFGNPCISS 261 Scheffersomyces stipitis CBS 6054
XP_002549858   223 LDDQIDRMINLYQEQNKTAD-LQFGNPCLST 252 Candida tropicalis MYA-3404
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap