2LOZ,2CY4


Conserved Protein Domain Family
PTB

?
pfam08416: PTB 
Phosphotyrosine-binding domain
The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) in the protein tensin tends to be found at the C-terminus. Tensin is a multi-domain protein that binds to actin filaments and functions as a focal-adhesion molecule (focal adhesions are regions of plasma membrane through which cells attach to the extracellular matrix). Human tensin has actin-binding sites, an SH2 (pfam00017) domain and a region similar to the tumor suppressor PTEN. The PTB domain interacts with the cytoplasmic tails of beta integrin by binding to an NPXY motif.
Statistics
?
PSSM-Id: 400632
View PSSM: pfam08416
Aligned: 13 rows
Threshold Bit Score: 154.82
Threshold Setting Gi: 74961911
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2LOZ_A         13 ACSVLYLTSVETESLTGPQAVAR--ASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFrRHYPVNSITFSSTDPQD 90   human
Q08509         64 QYRVEHLTTFVLDRKDAMITVEDgiRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNEL-ENFPLNTISHCQAVVHA 142  house mouse
XP_005168553   51 QYHVEHLTTFVMDRKEAMLTIEDgiRKLRLLDAKGKIWTQDMLLQVDNRAVSLIDHDSKNEL-ENFPLGSIQHCQPVTNA 129  zebrafish
Q9VHC3        580 ATNVLWLYSCDTESLTGNEAIRK--AIRQMYGQQPLPQPTEVHFKVSSQGITLTDNTRKKFFrKHYKADVISHCAIDPEN 657  fruit fly
Q68CZ2       1310 ACNVWYLNSVEMESLTGHQAIQK--ALSITLVQEPPPVSTVVHFKVSAQGITLTDNQRKLFFrRHYPVNSVIFCALDPQD 1387 human
P92160        272 ACNVVYVGSVDVESLTGNECVKRsiATCSQRAINGDSRAVSVHFKVSSQGVTLTDNTRKVFFrRHFNVQSVIFAGMDPIE 351  Caenorhabditi...
Q8TE68         35 QYPVNHLVTFCLGEDDGVHTVEDasRKLAVMDSQGRVWAQEMLLRVSPDHVTLLDPASKEEL-ESYPLGAIVRCDAVMPP 113  human
NP_001192218   28 QHRVEHLMTCKLGTQR-IQEPKDalQKLQEMDAQGRVWSQDLLLQVRDGWLQLLDIETKEEL-ESYRLDRIKVMDVALNT 105  cattle
2CY4_A         10 QYHVNHLVTFCLGEEDGVHTVEDasRKLAVXDSQGRVWAQEXLLRVSPSQVTLLDPVSKEEL-ESYPLDAIVRCDAVXPR 88  
CAG06824       64 QYRVEHLFTFELDGRQ-LRNVSDcvEQLQLLEEMGRVWGQSMLLQVQPPRLLLTDIETKMEL-ESVAIGDVLEVKAVLDS 141  spotted green...
KAE8623530     51 QHRVEHLLTCDLDKE--LRNVEDclKHLSFLEAQGRIWGQGLILQLENGEILLKDPETKDSL-EQLPLQNVDNCSSVLGG 127  tropical claw...
AAI02415       51 QYHVQHLATFIMDKSEAITSVEDaiRKLVQLSSKEKIWTQEMLLQVNDQSLRLLDMESQEEL-ENFPLPSVRHSQTVLNQ 129  cattle
NP_001072508   61 QYHIEHLTTFVMDRKDGVLTVDDgiRKLKLLDAKGKVWTQDMLLQVDDKGVSLYDVDTKSEL-ENFPLSSVQHCQAVMNA 139  tropical claw...
2LOZ_A         91 RRWTNpdgt--------tskIFGFVAKKPgSPWENVcHLFA--ELDPDQPAGAIVTFITKVLLGQ 145  human
Q08509        143 CSYDS---------------ILALVCKEPtQSKPDL-HLFQcdEVKANLISEDIESAISDSKGGK 191  house mouse
XP_005168553  130 CSYDS---------------ILALVCKESgQGKPDL-HLFQceDIKASLIHMDIESAISDHKGGK 178  zebrafish
Q9VHC3        658 RMWTSeges-------dkktIFAFVARRShSSTDNQcHVFC--DLSVSQPAAAIVSFANRTLPTE 713  fruit fly
Q68CZ2       1388 RKWIKdgp---------sskVFGFVARKQgSATDNVcHLFA--EHDPEQPASAIVNFVSKVMIGS 1441 human
P92160        352 RRFENtralgfhdgciaqarLFAFVARIP-SSSENAcHVFA--ELEPEQPGSAVVNFINKVMLAQ 413  Caenorhabditis elegans
Q8TE68        114 GRSRS---------------LLLLVCQEPeRAQPDV-HFFQglRLGAELIREDIQGALHNYRSGR 162  human
NP_001192218  106 GSYNS---------------VLSITVQDSdLRSTST-LLFQcqEVGAERLKTSLEKALEeeveqr 154  cattle
2CY4_A         89 GRSRS---------------LLLLVCQEPeRAQPDV-HFFQglLLGAELIREDIQGALQNYRSGR 137 
CAG06824      142 GPFNS---------------LLTVSVQTRrRGSTSI-FVFQs-DIRADLIQRDLSRAL----Lnk 185  spotted green pufferfish
KAE8623530    128 STYNS---------------LLTIKVQt--QQKTSI-FFFQcdEQPADVLHANLEKALKQFRLNK 174  tropical clawed frog
AAI02415      130 LRYPS---------------VLLLVCQDAdQSKPDV-HFFHcdEVEAELVQEDIESALADCRLGK 178  cattle
NP_001072508  140 CRYDS---------------ILALVCKEPaQSKADL-HLFQcdEIKASLVQRDIDSAISDSKGGK 188  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap