Conserved Protein Domain Family
DUF1737

?
pfam08410: DUF1737 
Domain of unknown function (DUF1737)
This domain of unknown function is found at the N-terminus of bacterial and viral hypothetical proteins.
Statistics
?
PSSM-Id: 400628
View PSSM: pfam08410
Aligned: 26 rows
Threshold Bit Score: 63.1021
Threshold Setting Gi: 123562704
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
gigasnome:DGI_1375   2 KYRILKASTEVELEEQVKQHLHEGWRPLGGVSIVQAEMafSKVLKFYQAVGKD 54  Desulfovibrio gigas DSM 1382 = ATCC ...
Q32GL9               5 HYDVVRAASPSDLAKRITQKLKEGWQPYGSALISTAGY----GAEFIQPVVSE 53  Shigella dysenteriae Sd197
WP_011776275        10 SYRLITGPDTRDFCERIHNSLAEGYVLHGSPAATFNGT----DVIVAQAVVlp 58  Micrococcaceae
WP_012086623        11 AYRLLTGPDDRSFCEKVSAALADGYVLHGSPSVTSTGG----RTIAAQAVVlp 59  Kineococcus radiotolerans
Q97HQ3               6 RYRLITGKDDSSFCERISKLLNEGYKLYGSPSCTFNGE----DVIVAQAVVID 54  Clostridium acetobutylicum
ABM03967             7 KYKLVTGKDDADFCKRITKLLAQGYELYGSPAISFNGE----HMVVIQAVVQV 55  Psychromonas ingrahamii 37
jgi:Despr_3229       3 LYSCITGPDDETFCKRVSDKLNRGWQLHGGPTLTFDGR----TVIAGQALVKE 51  Desulfobulbus propionicus DSM 2032
Q6F700              21 LYRYLTGPDDAQFCARVSKALNQGWTLYGSPTMSFNGT----QIIVGQAIIKE 69  Acinetobacter baylyi
jgi:Xaut_1972        3 LYRYLTGPDDAAFCKRVSAALNKGWQLHGAPTLTFDTV--QGRVICGQAIVKE 53  Xanthobacter autotrophicus Py2
WP_012611453         3 VYRYLTGPDDSAFCHRVTEALNKGWQLHGGPTLTYDPE--RKQVIAGQAIVKD 53  Desulfovibrio vulgaris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap