1WDZ


Conserved Protein Domain Family
IMD

?
pfam08397: IMD 
Click on image for an interactive view with Cn3D
IRSp53/MIM homology domain
The N-terminal predicted helical stretch of the insulin receptor tyrosine kinase substrate p53 (IRSp53) is an evolutionary conserved F-actin bundling domain involved in filopodium formation. The domain has been named IMD after the IRSp53 and missing in metastasis (MIM) proteins in which it occurs. Filopodium-inducing IMD activity is regulated by Cdc42 and Rac1 and is SH3-independent.
Statistics
?
PSSM-Id: 400620
View PSSM: pfam08397
Aligned: 5 rows
Threshold Bit Score: 303.307
Threshold Setting Gi: 71041817
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WDZ_B        20 YKTIMEQFN---PSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQG-SKELGDVLFQMAEVHRQIQNQLEE 95  human
O43312        16 FQTIISDMKgsyPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGgTREIGSALTRMCMRHRSIEAKLRQ 95  human
XP_018092896  19 iindmkasY---PTWEDFVSKATKLQSHLKSMIIVTGSFLDAFQKIADMAINTRGaTKEIGSALTRMCMRHRNIESRLKH 95  African clawed ...
Q765P7        15 FQAIVNDMKssyPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGaTRDIGSALTRMCMRHRSIETKLRQ 94  human
Q6UXY1        16 YKSIMEQFN---PALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALQSPT-SQILGEILVQMSDTQRHLNSDLEV 91  human
1WDZ_B        96 MLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQG---SKNPQKYSDKELqyIDAIS 172 human
O43312        96 FSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKK---GRGDIQPQLDSA--LQDVN 170 human
XP_018092896  96 LTVALTDSLINPLEGKIEEWKKVANQLDKDHAKEYKKARANIKKKSSDTIKLQKKVKK---GKDDARVQLDSA--LQDVS 170 African clawed ...
Q765P7        95 FTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARKellGKGDLQPQLDSA--LQDVN 172 human
Q6UXY1        92 VVQTFHGGLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSELWRMERKRDK----------NVREM--KESVN 159 human
1WDZ_B       173 NKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKgKELLAQKLPLWQQGVDSSGRI 239 human
O43312       171 DKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGE-ITHLQTISEDLKSLTMDPHKL 236 human
XP_018092896 171 DKYVLLEETEKKAVYRALVEERGRFCMFVSFLKPVLDEEIGMLGE-ITHLQTILEDLSSLTVEPSKL 236 African clawed frog
Q765P7       173 DMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGE-ITHLQGIIDDLVVLTAEPHKL 238 human
Q6UXY1       160 RLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRaRGMLQNRVLLWKEQ-SEASRS 225 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap