Conserved Protein Domain Family
FAE1_CUT1_RppA

?
pfam08392: FAE1_CUT1_RppA 
FAE1/Type III polyketide synthase-like protein
The members of this family are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species. The region featured in this family contains the active site residues, as well as motifs involved in substrate binding.
Statistics
?
PSSM-Id: 400617
View PSSM: pfam08392
Aligned: 23 rows
Threshold Bit Score: 410.86
Threshold Setting Gi: 75291026
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009108726  70 YIATRPK-PVYLVEYSCYLPPTHCRSSISKVMDIFYQVRKA-DPSRngtcddsswLDFLRKIQERSGLGDETHGPEGLLQ 147 field mustard
Q6K558        43 VLRRRRR-PVYLLNYSCHLPDVDRKVNLEVCEYFGQRCRHY-SDDT---------ADFMRLIYRKSGLGQETYAPPFIFS 111 Japanese rice
Q75M74        23 AAARRRQsRCYLLDYVCHKPSDDRKVSTEAAGAVIERSKRL-SLPE---------YRFLLRVIVRSGIGEETYAPRNVLD 92  Japanese rice
Q6K3E6        23 AAARRRRaTCYLLDYACHKPSDDRKVTTELAGAIIERNKRL-GLPE---------YRFLLKVIVNSGIGEHTYSPRNVLD 92  Japanese rice
Q9FW59        25 ARSRRRR--CYLLDYVCYKATDDRKLPTDLCGEIIQRNKLL-GLEE---------YKFLLKVIVNSGIGEETYGPRNIIG 92  rice
Q9LQP8        23 IDSKRDQ-NCYILDYQCHKPSDDRMVNTQFSGDIILRNKHL-RLNE---------YKFLLKAIVSSGIGEQTYAPRLFFE 91  thale cress
Q8LQT7        61 VRARRAR-GVYLVEYGCFRPRPCYRAPFATCLEHAHLMPYLvDEES---------VAFAIRLLERSGLGDETCVPDAYHY 130 Japanese rice
Q5Z6S3        79 YLVMRPR-AVYLVDYACFRTAPNCRVPFATFLEHARQVPTL-TERS---------VRFMTRLLERSGLGEETCLPPAHHY 147 Japanese rice
Q9C992        38 YYFFKPRcIIYLIDFSCYQPPDFLRAPVSNFIEHLTISGVF-DQES---------LDLQQKILERSGISDDASVPATVHE 107 thale cress
Q9FH27        42 YQRIRTRvKVYLLDFTCYRAPDSNRVPMSTLIETIYLDDKL-DQES---------IDFQARILERSWLSNQTSIPRSLME 111 thale cress
XP_009108726 148 VPPR--K--TFAAAREETEQVIIGALENLFKNT------NVNPKDIGILVVNSSMFNPTPSLSAMVVNTFKLRSNVRSFN 217 field mustard
Q6K558       112 GEFQ--K--TQAFAVQEAEEGLFATVAHLLAKS------DVRPRDVGFVVVACSMFSPAPSLASMIVRRFGMPPGTRTYS 181 Japanese rice
Q75M74        93 GREGe-P--THGDSLGEMEDFFGDSIAELFART------GFGPRDVDVLVVNASMFSPDPSLASMIVHRYGMREDVAAYS 163 Japanese rice
Q6K3E6        93 AREDc-P--TLRDALDEMDDFFDDAVAAVLARA------AVSPRDVDLLVINVGSFSPSPSLADRVVRRFGLRDDVMAYN 163 Japanese rice
Q9FW59        93 GGDArpD--RLAEGMEEMDETFHAVLDELFARSsaagggGVRPADVDLLVVNVSMFSPAPSLSARVVRRYNLREDVKVYN 170 rice
Q9LQP8        92 GREQr-P--TLQDGLSEMEEFYIDTIEKVLKRN------KISPSEIDILVVNVSMLNSTPSLSARIINHYKMREDIKVFN 162 thale cress
Q8LQT7       131 MPPD--R--SLRASRDESELVIFSAVDDVFARS------ALTPADIDVLIVNCSIFTPTPVFADMVVNRYKLRAEVQNVN 200 Japanese rice
Q5Z6S3       148 IPTY--KycTLEAARAEVDLVVFSAVDELFAKT------GVSPDDVDILVVNCSLFCPTPSFVDMIVNRYKLRSDIRSMH 219 Japanese rice
Q9C992       108 IPPN--A--SISAAREETHEILFAIVQDLFSKH------EIDPKSIDILVSNCSLFCPSPSITSMIINKFGMRSDIKSFS 177 thale cress
Q9FH27       112 IPLK--K--SLSSVKIETMTTIFTSVEDLLRKN------KLSPRSIDILITNCSLHSPSPSLSAMVINKFHMRSNIKSFN 181 thale cress
XP_009108726 218 LGGMGCSAGVIAIDLAKDLLHVHK-NTYALVVSTENITYNIYAGDNRSMMVSNCLFRVGGAAILLSNKPGDRRRSKYELV 296 field mustard
Q6K558       182 LAGMGCSAGTVGIDMAARALRVSRrGGYALVVVTENMSLNWYFGENKHMLVTNCIFRVGSAAALVTDVAARRGDAKYELV 261 Japanese rice
Q75M74       164 LAGMGCSAGLISLDLARNTLATRP-RALALVVSTESIAPNWYTGTDKSMMLANCLFRCGGASVLVTNDPVLRGRAKMELG 242 Japanese rice
Q6K3E6       164 LSGMGCSAGLVSVDLARNVMLTRP-RTMALVLTSESCAPNWYTGTDKSMMLGNCLFRCGGAAALLTNDPAFRSRAKMELR 242 Japanese rice
Q9FW59       171 LTGMGCSATLIALDLVNNFLRTHA-NKVALVMTSESIAPNWYAGNKRSFMLGNCLFRSGGCAYFLTNDPRHRRHAKLRLR 249 rice
Q9LQP8       163 LTAMGCSASVISIDIVKNIFKTYK-NKLALVVTSESLSPNWYSGNNRSMILANCLFRSGGCAVLLTNKRSLSRRAMFKLR 241 thale cress
Q8LQT7       201 LSGMGCSAGLVSVGLAKNLLQVSPpGTNVLIVSTEILSSQYYVGTERAMLLPNCLFRMGAAAMILSNSPDH---ARFRLG 277 Japanese rice
Q5Z6S3       220 LSGMGCSASLISIGLARNLLQVAPhGARALVVSTETITPNYYVGNERAMLLPNCLFRMGGAAALLSTSPA---KARFRLK 296 Japanese rice
Q9C992       178 LSGMGCSAGILSVNLVKDLMKIHG-DSLALVLSMEAVSPNGYRGKCKSMLIANTIFRMGGAAILLSNRKQDSHKAKYKLQ 256 thale cress
Q9FH27       182 LSGMGCAAGILSVNLANDLLQAHR-GSLALIVSTEALNTHWYIGKDRSMLLTNCLFRMGAAAVLMSSNDHDRDNAKYELL 260 thale cress
XP_009108726 297 HTVRTHTGADDKSFRCVQQGDDENGKTGVSLSKDITDVAGRTVKKNIATLGPLILPLSEKLLFFVTf-MGKKL 368 field mustard
Q6K558       262 RTLRTHHGGDDAAYNAAVQMEDEEGNVGVALTKDLVRVAGAGLRQHIATLAPHVLPVSELLRYVWR--VARAY 332 Japanese rice
Q75M74       243 CLVRANIAANDDAHACALQREDDDGTVGISLSKALPKAAVRAFAANLRRLAPRILPITELARFAAQllITKKL 315 Japanese rice
Q6K3E6       243 CLVRAHIGAHDDAHAAAVHREDADGRLGVSLSKALPKAAVRAFTENLQRLAPRILPAGELARFAARllL-RKL 314 Japanese rice
Q9FW59       250 HLVRTHTGASDDAYSCALQMEDDAGRPGFHLGKDLPRAAVHAFVKNLRLLAPRVLPLPELLRLAFAtfLSSGR 322 rice
Q9LQP8       242 CLVRTHHGARDDSFNACVQKEDELGHIGVHLDKTLPKAATRAFIDNLKVITPKILPVTELLRFMLCl-LLKKL 313 thale cress
Q8LQT7       278 RVVRTVTAARDSDYRCVFQEEDEQGNTGIRLSKDLATTAGHALKSNIAAFGPLVLPASEQLLVAISf-LKRKL 349 Japanese rice
Q5Z6S3       297 HVVRTLTGAEDSAHHCVFQEEDEHGSIGINLSKDLMTIAGNALKANITAIAPLVLPASEQLKFALAf-IARKA 368 Japanese rice
Q9C992       257 HIIRTHVGSDTESYESVMQQVDEEGKVGVALSKQLVRVASKALKINVVQLGPRVLPYSEQLKYIISf-IQRKW 328 thale cress
Q9FH27       261 HVVRKNKAKDDRAYRCIYQDIDSDEKQGVSITKDVISVAGDMLKMNLTSLGPLVLPYLEQFQYVIQhiLCKKL 333 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap