Conserved Protein Domain Family
NPP

?
pfam08384: NPP 
Pro-opiomelanocortin, N-terminal region
This family features the N-terminal peptide of pro-opiomelanocortin (NPP). It is thought to represent an important pituitary peptide, given its high yield from pituitary glands, and exhibits a potent in vitro aldosterone-stimulating activity.
Statistics
?
PSSM-Id: 400610
View PSSM: pfam08384
Aligned: 14 rows
Threshold Bit Score: 70.5114
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003227954  28 CLDGGWCQDMATEADLMECLRACRDSLSLsdETPIYPGHGHMKPL 72  green anole
XP_007244740  29 CWENGPCRDLSSEEQILDCMKSCKSNLKM--ESPLFPGEGHLQPL 71  Mexican tetra
XP_006626112  24 CWEHSQCRDLSSEENILECIQACKSDLTA--ESPIFPGNGHLQPP 66  spotted gar
Q7ZT18        30 CWENARCRDLSTEENILECIQLCRSELTD--ETPVYPGESHLQPP 72  zebrafish
1_pfamImport   2 CWDHPSCQALDSEASSMECIHHCRSDLTA--EAPVVPGSAHLQ-- 42 
ALD51514      23 CWEHPSCQDVNSETSMMECVELCRSDLTA--EAPVVPGAAHLQPP 65  three-spined stickleback
XP_019206385  23 CWDHPVCQEVNSERSMMECIQLCHFENN---EKPITPGDAHLQPP 64  Nile tilapia
Q95J84        28 CLQASNCRDSKAEDGLVECIKSCKMDLSA--ESPVFPGNGQYEPL 70  gray short-tailed opossum
XP_008253036  23 CLESSQCQELTTESHLLQCLRACQLDRSA--ETPVFPGNGDAHPL 65  rabbit
XP_006002164  27 CWESSRCRDLSTEANVLECISACKADLSA--ESPVYPGNGHMQPL 69  coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap