Conserved Protein Domain Family
BRX

?
pfam08381: BRX 
Transcription factor regulating root and shoot growth via Pin3
The BREVIS RADIX (BRX) domain was characterized as being a transcription factor in plants regulating the extent of cell proliferation and elongation in the growth zone of the root. BRX is rate limiting for auxin-responsive gene-expression by mediating cross-talk with the brassino-steroid pathway. BRX has a ubiquitous, although quantitatively variable role in modulating the growth rate in both the root and the shoot. The family features a short region of alpha-helix, approximately 60 residues in length, which is found repeated up to three times. BRX is expressed in the vasculature and is rate-limiting for transcriptional auxin action.
Statistics
?
PSSM-Id: 400608
View PSSM: pfam08381
Aligned: 49 rows
Threshold Bit Score: 76.0797
Threshold Setting Gi: 302822159
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2QWK1            108 EREWVAEPEPGVLLTLAPRADGvSNRLRRIRFREEVFDAWAAQCWWADNHDRIAELY 164  Japanese rice
XP_002868286     1756 GKELIEQFEPGVYVTYVLHKNG-GKIFRRVRFSKRRFDEHQAEEWWNSKKDRLLKRY 1811 Arabidopsis lyrata subsp. lyrata
KRH65503          964 eIQVIEKFERGVYVILMLQSDG-TKIFKRVKFSKRRFTENQAEEWWNQNKSRVLREY 1019 soybean
KRH00393          983 EMQVMEQFEPGVHVTLIVKPGG-VRIFKRVKFSKRRFHEHQAEEWWSKNKDRVLRKY 1038 soybean
KRH31700          994 EKSVIEQFEHGVYVTLVVLPRG-YKVFKRIRFSKRRFNEKQAEEWWNQNKDKVHSKY 1049 soybean
JCVI:AT4G16990.5  275 KAEWI-HLALGVSILLNIRSDG-TTILKHLSYNRSM--AQQAKIWWYENLERVCKKY 327  thale cress
EMS61170           27 hDEWLEEYEAGVFMKLKDLGDG-TRELKRVRFSKRRFGEHQAENWWKENREKVYERY 82   Triticum urartu
XP_015692054      991 idNVTEQIEHGVYVTFSISPCG-KKDIKRIRFSRKHFGEKEAQHWWEENKTRVYEKY 1046 malo sina
VAH51843          968 veGVIEQIERGVYVTLAVSPDG-RKDIRRIRFSRKHFGEKAAQCWWEENKSRVYANY 1023 durum wheat
NP_001319973      379 EKEKIEYCEPHVYITPAIFSDG-TRAPKYVESSRRVTQVHHAKTWWPENCEKVYENH 434  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap