Conserved Protein Domain Family
MAP2_projctn

?
pfam08377: MAP2_projctn 
MAP2/Tau projection domain
This domain is found in the MAP2/Tau family of proteins which includes MAP2, MAP4, Tau, and their homologs. All isoforms contain a conserved C-terminal domain containing tubulin-binding repeats (pfam00418), and a N-terminal projection domain of varying size. This domain has a net negative charge and exerts a long-range repulsive force. This provides a mechanism that can regulate microtubule spacing which might facilitate efficient organelle transport.
Statistics
?
PSSM-Id: 369841
View PSSM: pfam08377
Aligned: 3 rows
Threshold Bit Score: 1763.8
Threshold Setting Gi: 1626087835
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_017451788  374 DKVADVPVSEATTVLGDVHSPAVEGFVGEN--ISGEEKGTTDQE---KKETSTPSVQEPTLTETEPQTKLEETSKVSIEE 448  Norway rat
P11137        377 DKMAEAPPSEAMTLPKDAHIPVVEEHVMGK--VLEEEKEAINQEtvqQRDTFTPSGQEPILTEKETELKLEEKTTISDKE 454  human
XP_028924485  459 DKMGDMPMSTVITQSMEVHKLTIRESHGQRgcGVGEDKDIPRWEndlRKEHFLPNGQKFALFESEPYRKPEEKSSVLV-- 536  platypus
XP_017451788  449 TVAKEEESLKLKDDKAGVIQTSTEHSFSkeDQKGEEQTIEALKQDSFPISLEQAVTDAAMATKTLEKVTSEPEAVSEKRE 528  Norway rat
P11137        455 AVPKESKPPKPADEEIGIIQTSTEHTFS--EQKDQEPTTDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPSALIEKSS 532  human
XP_028924485  537 SLPQDSKLLKGLDEEKSTTRSLGGQTIKkeEPPSKGAQVDQFRRDSFPGAQGRDLMLAAALSETLDKMPVAPSPRSDPA- 615  platypus
XP_017451788  529 IQGLFEEDIADKS-KLEGAGSATVAEVEMPFYEDKSGMSKYFETSALKEDVTRSTGLGSDYYELSDSRGNAQESLDTVSP 607  Norway rat
P11137        533 IQELFEMRVDDKD-KIEGVGAATSAELDMPFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRESVHESIDTMSP 611  human
XP_028924485  616 -RSLSQEREIGKDiRADKAGAPPPTE-ERPLDEDKSGMSKYFETSTLKEEATKSLQQDSDYYELSDSKESAYESYDTVAP 693  platypus
XP_017451788  608 KNQQDEKELLA-KASQPSPPAHEAGYSTLAQSYtsdhPSELPEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSL 686  Norway rat
P11137        612 MHKNGDKEFQTgKESQPSPPAQEAGYSTLAQSY----PSDLPEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSL 687  human
XP_028924485  694 MFKDGDQES--------SAPACEVGYSTLAQGY----PSDIAEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSL 761  platypus
XP_017451788  687 GLGGRSAIEQRSMSINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPPTTPAVEKIPCFPI------ 760  Norway rat
P11137        688 GLGGRSAIEQRSMSINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPATTPALEKAPCFPV------ 761  human
XP_028924485  762 GLGGRSAIEQRSMSINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPATTPGLEKAPGFPTegreek 841  platypus
XP_017451788  761 ----------------------ESKEEEdKTEQAKVTGGQTTQVETSSESPFPAKEYYKNGTVMAPDLPEMLDLAGTRSR 818  Norway rat
P11137        762 ----------------------ESKEEE-QIEKVKATGEESTQAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSR 818  human
XP_028924485  842 eeegeeeeeeeeeeeveeaeqaEGQKKAgKAVEV-----ESSQVESPSESPFLAKEYYKNGAVMAPDLPEMLDLAGTRSR 916  platypus
XP_017451788  819 LASVSADAEVARRKSVPSEAVVAESSTG-LPPVADDSQ-PVKPDSQLEDMGYCVFNKYTVPLPSPVQDSENLSGESGSFY 896  Norway rat
P11137        819 LASVSADAEVARRKSVPSETVVEDSRTG-LPPVTDENHvIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFY 897  human
XP_028924485  917 LASVSADTESARRKSVPADVGGHDSGAGvLSPIGNKNHvAVKDDSQMEDLGYCVFNKYTVPLPSPVQDSENLQGDSGLFY 996  platypus
XP_017451788  897 EGTDDKVRRDLATDLSLIEVKLAAAGRVKDEFTAEKEASPPSSADKSGLSREFDQDRKANDKLDTVLEKSEEHVDSK--- 973  Norway rat
P11137        898 EGTDDKVRRDLATDLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRLDTVLEKSEEHADSK--- 974  human
XP_028924485  997 EGADDKLRRDLATDLSLIEVKLAATGRVKQDVGGEKEPSPPVSGDKAGLSRELDQDRKATDKLDTVLEKGEEPMDSKetl 1076 platypus
XP_017451788  974 ---EHAKESE-EVGDKVELFGLGVTYEQTSAKELITTKETAP---ERAEKGLSSVPEVAEVETTTKADQGLDVAAkkddQ 1046 Norway rat
P11137        975 ---EHAKKTE-EAGDEIETFGLGVTYEQALAKDLSIPTDASS---EKAEKGLSSVPEIAEVEPSKKVEQGLDFAV----Q 1043 human
XP_028924485 1077 lpeEHGKLGPgEVVTKVEMVSSEPAVDLASIQVMTQSQDTSPfmtEKVEPLLGSVPEVAETEPLPKAEPRTDPSAkadpS 1156 platypus
XP_017451788 1047 SPLDIKVSDFGQMASGMSVDAGKTIELKFEVDQQLTLSSEAPQETDSFMGIESSHVKDGAKVSETEVKEKVAKPDLVHQE 1126 Norway rat
P11137       1044 GQLDVKISDFGQMASGLNIDDRRATELKLEATQDMTPSSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLVHQE 1123 human
XP_028924485 1157 QPV-VQVSDFGSTAAEQDGASQGPA-----AQQEGAGLARGGQDVELLVGAEAGDGKEGTRGSEAEIKEKVAKPDLVHQE 1230 platypus
XP_017451788 1127 AVDKEESYESSGEH----ESLTMESLKPDEGKKETSPETSLIQDEVALKLSVEIPCPPPVSEADSSIDEKAEVQMEFIQL 1202 Norway rat
P11137       1124 AVDKEESYESSGEH----ESLTMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFIQG 1199 human
XP_028924485 1231 AVDKEESYESSGEHdvtpEGGAGEPSKPDEGKKEPAKEPPTLPDEVTVR-ALEAELPP--SSVDAVLVEGADIQMEPIQQ 1307 platypus
XP_017451788 1203 PKEESTETPDIPAIPSDVTQPQPEAVVSEPAEVRGEE-----EEIEAEGEYDKLLFRSDTLQITDLLVPGSREEF----V 1273 Norway rat
P11137       1200 PKEESKETPDISITPSDVAEPLHETIVSEPAEIQSEE-----EEIEAQGEYDKLLFRSDTLQITDLGVSGAREEF----V 1270 human
XP_028924485 1308 PKRDSQEAPGISITPSEALEP---TLLKPGSEASADEnkegqEEVEARGESDRLLFRSETLQLADLSIPTDREESekrgV 1384 platypus
XP_017451788 1274 ETCPGEHKGVVESVVTIEDDFITVVQTTTDEGELGSHSVRFAAPVQPEEERRPYPH------------------------ 1329 Norway rat
P11137       1271 ETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVERRPSPH------------------------ 1326 human
XP_028924485 1385 EDVP-EHKGGIESVVTIEDDFITVVQTTTDDGESGSHSVRFAALDQAEVESRPSPPggeeeeeeeeeeeeegggggggee 1463 platypus
XP_017451788 1330 ----D-EELEVLMAAEAQAEPKDGSPDAPATPEK-EEVPFSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDRSILT 1403 Norway rat
P11137       1327 ----DeEEFEVEEAAEAQAEPKDGSPEAPASPER-EEVALSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDRSIMT 1401 human
XP_028924485 1464 eeeeA-SEPEAEELMDDRPEPKEGSPEAPASPDKeEEVGLSEYKTETLDDYRDETTIDDSIMDADSLWVDTQDDDRSIMT 1542 platypus
XP_017451788 1404 EQLETIPKEERAEKEARRPSLEKHRKEKPFKTGRGRISTPERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKSEVQAHSP 1483 Norway rat
P11137       1402 EQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRISTPERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHSP 1481 human
XP_028924485 1543 EQLETVPKEEKSEKEARRPSLDKHRKEKPFKAGRGRISTPERKIAKKEPSTVSRDEVRKKKAVYKKAELAKKTEVQAHSP 1622 platypus
XP_017451788 1484 SRKLILKPAIKYTRPTHLSCVKRK 1507 Norway rat
P11137       1482 SRKFILKPAIKYTRPTHLSCVKRK 1505 human
XP_028924485 1623 SRKFILKPAIKYTRPTHLSCVKRK 1646 platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap