Conserved Protein Domain Family
IGF2_C

?
pfam08365: IGF2_C 
Insulin-like growth factor II E-peptide
This domain is found at the C-terminal domain of the insulin-like growth factor II (IGF-2, also see pfam00049) in vertebrates and seems to represent the E-peptide.
Statistics
?
PSSM-Id: 400596
View PSSM: pfam08365
Aligned: 8 rows
Threshold Bit Score: 70.6128
Threshold Setting Gi: 395545244
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001116438 117 KYSKYDVWQKkSSQRRQRDAPNILRARRYRWQVEGLQAAEEAKAlHRPLISLPSQRP 173 zebra finch
ELK13207     116 KFFQYDSWMQ-SAQRLRRGLPALLRVRRGRMLARELEAFREATR-HRPLMALSTDDP 170 black flying fox
EHB15714     168 KFFQYDTWRQ-STQRLRRGLPALLRARRGRMLSRELEALREAKR-HHPLTVLTSKDP 222 naked mole-rat
XP_002821420 112 KFFQYDTWKQ-STQRLRRGLPALLRARRGHVLAKELEAFREAKR-HRPLIALPSQDP 166 Sumatran orangutan
XP_003774514 116 KFFKLDTWQK-SAHRLRRGLPALLRARRDRLRAQALEAIREAQR-HRALISLPSEDP 170 Tasmanian devil
AAI56000     115 KSSKYDIWQRkSIHRLRRGVPAIVRARQYRLLMQQAEESEQALS-HRPLTTLPITRP 170 tropical clawed frog
Q5U3B4       129 KYSKYEVWQQkAAQRLRRGVPSILLARKFRRQMEKIQDEEQTSF-HRPLMTLPNRQP 184 zebrafish
CAG01142      96 KYSKYEVWQRkAAQRLRRGVPAILRAKKFRRQAEKIKAQEQTVF-HRPLISLPSKLP 151 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap