Conserved Protein Domain Family
Flexi_CP_N

?
pfam08358: Flexi_CP_N 
Carlavirus coat
This domain is found together with the viral coat protein domain (pfam00286) in coat/capsid proteins of Carlaviruses infecting plants.
Statistics
?
PSSM-Id: 149427
View PSSM: pfam08358
Aligned: 25 rows
Threshold Bit Score: 68.7864
Threshold Setting Gi: 66774110
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q70DZ4    63 RLTQLAALLRXXXTSVHVTNMALEI-GRPIFQPPPNMGGVPSKyVQSRYQLIFL 115 Chrysanthemum virus B
A0AAR0    51 RFRKLKEYLLKNMRSKQIGNIGLEI-GRPALKPMDEIRPDLTN-IFTMPTIDIL 102 Narcissus symptomless virus
Q02106    74 RFNLLKEWHLNQQVNNKVKNPAMESeTEPAL--ADELKPDMSN-LFARPTVTDL 124 Poplar mosaic virus (ATCC PV257)
Q6UC80   108 RLEALKEWYRANMRPADVVNPLMQS-GLKQMEVTDKLKEDSTN-LYSRPALNTL 159 Melon yellowing-associated virus
O70731    72 RFNKLKKFQADNMTAGEIKNGGFET-GRPKLNIAANLRGDTAN-VFTRPSMDAL 123 Garlic common latent virus
O92527    59 RFQKLKEFNSQNLTAGELKNGGFES-GRPPAKISEHLRGSTAN-VFTRPSLDAL 110 Carnation latent virus
ABS89249  68 RFHNLVKFETSNLNAGTLKNGGFEK-GRPKAVLSDALKGDTSD-VFTRPSLDAL 119 Coleus vein necrosis virus
Q913Z5    49 RFQALQDLTAKSIAGSSIVNGGWEA-DRKRLKVSDKMKLDGSN-IFTRPTLDDL 100 Alfalfa latent virus
Q4F974    48 RMARLREFLMKQQRAVQVTNPSFEL-GRPKLKMLDSVRSDPTN-LYNKPTIDQL 99  Hippeastrum latent virus
ABL09850  42 RLDDLRAFLRKTQSASEITNPGFEL-GRPALKESTFNSDKHTH-IYGKWSIDQL 93  Cowpea mild mottle virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap