5KSZ,4C0J


Conserved Protein Domain Family
EF_assoc_2

?
pfam08356: EF_assoc_2 
EF hand associated
This region predominantly appears near EF-hands (pfam00036) in GTP-binding proteins. It is found in all three eukaryotic kingdoms.
Statistics
?
PSSM-Id: 400591
View PSSM: pfam08356
Aligned: 72 rows
Threshold Bit Score: 107.944
Threshold Setting Gi: 410082724
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5KSZ_A        43 TPLAPQALEDVKNVVRKHISDGVADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYL-FPLLKIPPDC 121
XP_001744671 225 QPLSQAELASIINIVQSSLPQGVEDDALTLEGFEAVLKLFVERGRLETTWQVLRRFGYQNDLTLLPAYI-RPELEVCEDA 303 Monosiga brevic...
XP_004247162 228 APLQPAEIVGVKRVVQEKLPQGVNDLGLTLTGFLFLHALFIEKGRLETTWTVLRKFGYNDEIKLKDDNLtIP-FKKAPDQ 306 tomato
EDQ59391     223 APLQPTEIEGVKKVVSEKMADGVSNNGLTLTGFFFLHALFIERGRLETTWTVLRKFGYDDEIKLRDDLVaNPAFKRASDQ 302 Physcomitrella ...
KRG95516     229 APLQSSEIAGVKRVVQQKVPEGFNSHGLTFPGFIYVHNMFLKKGRPETLWAVLRNFGYDNNLKLMDDFLpVPS-KHAFDQ 307 soybean
EFH58666     230 TPLVPCEINQMKKAMQVKFPQGVNERGLTLDGFLFLNTRYIEDARIQTLWTMLRKFGYNNDLRLGDDLIpYSSFKREADQ 309 Arabidopsis lyr...
Q55G45       226 ETMTSEEIQNIQQFVLSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYV-HPTLQVPPNH 304 Dictyostelium d...
KJE94590     234 APLQQRELDGVKEVVRQHDANDVTAAGLTEAGFLFLHKLFIQRGRLETTWMVLRKFGYDDSLVLRDDFL-HPPIEVDAES 312 Capsaspora owcz...
RID71146     231 EPMTPSQIRGLIDFVQARSPLGVDENGITIEGFLFINKYLVEQGRIRKVWDILRKFGYNNELRLADDMIpYSSFKHMPDQ 310 field mustard
RQM00936     230 APLQPSEIEGVKRVVQEKLPEGVNERGLTVTGFLFLHALFIEKGRLETTWTVLRKFGYNNEIRLADELLpPSLFKRTPDQ 309 Brassica cretica
5KSZ_A       122 TTELNH 127
XP_001744671 304 IAEPSE 309 Monosiga brevicollis MX1
XP_004247162 307 SLELTS 312 tomato
EDQ59391     303 SIELTE 308 Physcomitrella patens
KRG95516     308 SVELTG 313 soybean
EFH58666     310 SVELTN 315 Arabidopsis lyrata subsp. lyrata
Q55G45       305 NTILSS 310 Dictyostelium discoideum
KJE94590     313 TTELTS 318 Capsaspora owczarzaki ATCC 30864
RID71146     311 SVELSD 316 field mustard
RQM00936     310 SVELTD 315 Brassica cretica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap