Conserved Protein Domain Family
DUF1729

?
pfam08354: DUF1729 
Domain of unknown function (DUF1729)
This domain of unknown function is found in fatty acid synthase beta subunits together with the MaoC-like domain (pfam01575) and the Acyltransferase domain (pfam00698). The domain has been identified in fungi and bacteria.
Statistics
?
PSSM-Id: 369827
View PSSM: pfam08354
Aligned: 8 rows
Threshold Bit Score: 441.899
Threshold Setting Gi: 502126577
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
GAC76041            771 KIICQWTGGRAGGHHSTEDFHQPILQTYASLRKQKNLILVGGSGFGDAEGVWPYLTGEWSVKLGYAPMPFSAFLFASWML 850  Moeszio...
XP_011315624        743 PVVLQWTGGRGGGHHSNQDFHAPLISMYGKIRAQDNVVLVVGSGFGGPSDTLPYITGKWASDMGLPPMPVDGILLGSRVM 822  Fusariu...
GAC75475            822 PIIVQWTGGRAGGHHSNEDAFDPLLSTYASLRKAANIYIVVGGGLSHPNDGIEWLDGGWSTRFGSSPMPVDGILLGTAIT 901  Moeszio...
CeBiTec:CGLY_02520  550 SIILQVEDGHAGGHHSWENLDDLLTATYAEIRRQKNVVLCVGGGIGTPERSADYLSGDWSVALGLPSMPVDGVLVGTAAM 629  Coryneb...
WP_012715269        514 TVIMQLEGSAAGGHHSLEGLDEVLVATYARIRERDNVLLAVGGGIGNPARGAEYLLGTWAQRFGLPAAPVDAIMVGTAAM 593  Coryneb...
CBX98970            572 TIGLQWTGGRAGGHHSMEEFEPPILESYSRIRECDNIVLIAGSGFGDAESSIAYLTGQWSRSFGRPPMPFDGILLGSRIM 651  Leptosp...
CCK69059            728 PIVLQWTGGRAGGHHSFEDAHAPMIQMYSKIRRQSNIILIAGSGFGSAEDTYPYLTGEWSKEYNYPPMPFDGFLFGSRVM 807  Kazachs...
EKG22541            718 PVLLQWTGGRGGGHHSYEDFHAPILDTYAEIRARPNVVLVAGSGFGDAAGIYPYLSGEWAQAYGRAPMPFDGALLGSRMM 797  Macroph...
GAC76041            851 VAKEAATADAVKQLLVDTPGC-GDD------------KWQDTYGKGAGGTITCNSELGESISYVHNRAAALWRQLDDQLF 917  Moeszio...
XP_011315624        823 VAKEAHTSTEAKHLIVATEGA-PDD------------EWSGTYSRPTGGVLSVISEMRQPIHKIATRAVRLWHELDQTIF 889  Fusariu...
GAC75475            902 VVAEAATSSAVKRRIVEAPGC-KDE------------EWQASYVRPVGGVVSVVSEYGEPIHVLANRCGRFWKMLDEQLF 968  Moeszio...
CeBiTec:CGLY_02520  630 TTKEAKTTDEIKQLLVDTPGV---AdetgaaftapngGWIAP-GNSAGGATSGLSHLRADIHEIDNSAAKCMRLIQEVGG 705  Coryneb...
WP_012715269        594 AAKESTASESVKQALV---------------------------TAHSGDVVSGRSDLGADIHELDNSFARAGRLLDEVAG 646  Coryneb...
CBX98970            652 IAKEAHTALQAKHLISQTPGV-DAC------------NWRTSVKKGKGGVISIHSEFGQPIHVLATRGALLWKAFDERIF 718  Leptosp...
CCK69059            808 IAKEAKTSRDAKKAIVECPGI-VDG------------QWENTYKKPTGGIVTVRSEMGEPIHKIATRCVIFWKEMDETIF 874  Kazachs...
EKG22541            798 VAREAHTAPESREVIVAAPGLeSER------------DWDRTYDGPAGGVVTVQSEMGQPIHKIATRGVKLWAELDKTVF 865  Macroph...
GAC76041            918 SL-PREKQRVWLSEKKSWLIERLNKDFQKPWFPAK-LDGSaLMN-VADMTYEEVTRRMLQLLFVSHQSRWIDPSLKKLFG 994  Moeszio...
XP_011315624        890 HL-GPKERVAEITRRRDEIIRRLNHDYHRVWFGCSgPTRD-PVE-LDEMTYSEVLHRFVELAYVTAEHRWVHLSWKKLFS 966  Fusariu...
GAC75475            969 SLpNAEQRGRFLRLNRASLIARLNGDYQRPWFCID-QHGA-PVDsLEQMSYYLVARRFIDLARHPHTGEWLTPSWHRIAQ 1046 Moeszio...
CeBiTec:CGLY_02520  706 SLeAVNAR-------RDEIIDAMNKT-AKPYF------GE-----LEKMTYAEVVRRFAELSF-----PWVDPSWLQRFQ 761  Coryneb...
WP_012715269        647 DAaAVETR-------RAEIIEAIGRT-CKPYF------GD-----LDEMSYSEWLQRYLELSYLD---GWGDESWFSRFT 704  Coryneb...
CBX98970            719 CIrDVHKRLIYLRKYRDWIIQALNSDYVRPWLAVD-ERGN-NVQ-MEEMKYSEMVRRLCLLMSTTSRRNWIDTSYCRIVM 795  Leptosp...
CCK69059            875 NL-PKNKLQPALDAKKEYIIKKLNADTQKPWFAT--VNGE-IRD-LPAMTYEEVAQRLVDLMFIKSTKSWIDVTLRNFTG 949  Kazachs...
EKG22541            866 SL-PRAQRPAALEKQRRALIARLNADYAKPWFGVD-AEGTgPAE-LAEMPYARVVKRLLELMYLPHRGAFIDPSYEVLLR 942  Macroph...
GAC76041            995 DWCRRVEERFagietAGKKESLLQSYSVLDkQP--ASFVDTFFAEyt----gaKEIRLAAEDVGYFLTICQRRGQKPVPF 1068 Moeszio...
XP_011315624        967 ELLTRTMSRL-----HRTSDSRSETLVDDLdDP--YSTLATLTDA--------SAQLITYEDSIYFLQLFRRRGQKPVPF 1031 Fusariu...
GAC75475           1047 QLLQRIQERL------LPAEAPFETRELLElDPqnGQQAQTVLETlpqvvpgsTTSLMLEEDCQWVLQLWSGRGIKPVPF 1120 Moeszio...
CeBiTec:CGLY_02520  762 ELLQRVEARLtt-aeHGPVETLFPTVESAE-DP--EAAVTTLVAAyp----saEVDTLTPLDTAWFIALCRKYP-KPMGF 832  Coryneb...
WP_012715269        705 RMVARAEARLhp-tdHGEIALCVEADRE---NP--AEAINQLTELyg----daA---LHPTDAAWFIQLVDGPG-KPANF 770  Coryneb...
CBX98970            796 DFVHEVGSRS------------SISVECLSdNP--ATLPRDFEALfg----slAATSMYPEDCMILMALFQRQGIKPVPF 857  Leptosp...
CCK69059            950 DFLRRVEERFtn----akTTSVLQSYTMLD-KP--EEALEAVFTAfp----aaKEQYLNAQDVDHFLNMCQNPVQKPVPF 1018 Kazachs...
EKG22541            943 DVAQRALDRLhp----gaEPLQAEDTAAL------VLLIGDFEAVcp----gaETQTLHPEDERWFVRRCKARGMKPVNF 1008 Macroph...
GAC76041           1069 IPELGDNFQTLFKKDSLWQSEDLDA--VVGQDAQKVIILQGSVAVRHCTKANVPAGEML 1125 Moesziomyces antarcticus T-34
XP_011315624       1032 IPVLDADFETWFKKDSLWQSEDIAA--VPNHDAQRVCILHGPVAAQYSTKVDEPVGEIL 1088 Fusarium graminearum PH-1
GAC75475           1121 VPALDENFESYFKKASNRGPCRLRHrrFPNQDPERVLCLVGAVALQHCNRANVGVKELL 1179 Moesziomyces antarcticus T-34
CeBiTec:CGLY_02520  833 VPAIDEDLLAWWGKDCLWQAQDDRY------SADQVRIIPGPVSVSGITTVNEPVADLL 885  Corynebacterium glyciniphilu...
WP_012715269        771 VPVIDTDVRRRWRRDTLWQAHDEHY------EADEVCIIPGTAAVAGIEQANEPVAQIL 823  Corynebacterium aurimucosum
CBX98970            858 IPCLDENFEKWFKKDTLWQSENIDS--VFDSDIQRVIVIHGPVAARFSTIVDEPVKTIM 914  Leptosphaeria maculans JN3
CCK69059           1019 VPVLDHRFEFFFKKDSLWQSEHLEA--VVDQDVQRTCILHGPVAAQYTKVIDEPIKSIM 1075 Kazachstania naganishii CBS ...
EKG22541           1009 IPALDEDFEFFFKKDSLWQSENVDA--VVGRDAGRVCILQSPVSVRYSTRADESAKEIL 1065 Macrophomina phaseolina MS6
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap