4M8N


Conserved Protein Domain Family
Plexin_cytopl

?
pfam08337: Plexin_cytopl 
Click on image for an interactive view with Cn3D
Plexin cytoplasmic RasGAP domain
This family features the C-terminal regions of various plexins. Plexins are receptors for semaphorins, and plexin signalling is important in path finding and patterning of both neurons and developing blood vessels. The cytoplasmic region, which has been called a SEX domain in some members of this family, is involved in downstream signalling pathways, by interaction with proteins such as Rac1, RhoD, Rnd1 and other plexins. This domain acts as a RasGAP domain.
Statistics
?
PSSM-Id: 400574
View PSSM: pfam08337
Aligned: 51 rows
Threshold Bit Score: 577.214
Threshold Setting Gi: 341888335
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4M8N_A         47 AIPFLDYKHFASRIFF------------------------PE-------------AGtltavmirdiGEDSEQTTVDE-K 88   zebrafish
EGD75945     1444 eahprpfGEYARRVYF------------------------TAldthpl-pvrprfPG----------TND---------C 1479 Salpingoeca r...
EKC27333      182 GIPYHSYQSYTQYILF------------------------PKeveaatia-------------sllehsgFSSKNAEK-A 223  Pacific oyster
O45657       1194 GPELINFPHFVENLLWsdnnlt---------------------------sapslaRT----------LPV---------T 1227 Caenorhabditi...
EGW12632       32 GIPFLEYKHFVTRTFFpkcsslyeekyvlpsqtlnsqgssPPqethpl-lgewniP-------------EHCRPSMEE-G 96   Chinese hamster
9_pfamImport    1 GIPFLEYKHFVTRTFF------------------------PKaggspf-spkssaPG----------KQSGCRPNMEE-G 44  
XP_014345025 1248 GIPFLEYKDFVTRTFFpkpswdyeerymqlfpqtkpevagPVsethplllgewkvP-------------ESSRLNVEE-G 1313 coelacanth
XP_018671834 1290 riiylppwEYITQVLF------------------------NQrsghpv----------------ldenamVGQGTVKQdA 1329 vase tunicate
XP_030856366 1291 GMPFVSGADYIRNMLFwglkvq-------------pmtndPE----------------------------LPQESIKQ-A 1328 purple sea ur...
XP_030838904  313 GVPFVNALDYSKNMLFaglavl-------------ppttdPE----------------------------YMNSDLET-A 350  purple sea ur...
4M8N_A         89 CLAFAELIRDKQFLSCFVHALEEQK-NFSIKDKCTVASLLTLAL--HGDLLYLTEIMEDLLQSLMDQSSNAN--PKLLLR 163  zebrafish
EGD75945     1480 IEQFTFFLQQDDFLRAFVGVMEGEGrAFSVRDRCQVASLLMCSA--NGDEAMGTHTLSTLLDQYFTA--NSRrdPRLMLR 1555 Salpingoeca r...
EKC27333      224 MDQFDKLMSNKYFVKSLIGTLEKQR-KITLSDKAQFAANFSVIM--MGKMRDFFEIVNCLLSTLVDSAN--KkqHKTLFN 298  Pacific oyster
O45657       1228 LAQFHALLSFKGFIFTIVEAAESDV-SISTSEKSMLASLLISVL--LRNFSYCTEVVVDLLRAHIARSVQNKr-AELLFR 1303 Caenorhabditi...
EGW12632       97 ISLFSSLLNNKHFLIIFVHALEQQK-DFAVRDRCSLASLLTIAL--HGKLEYYTSIMKELLVDLIDASA-AKn-PKLMLR 171  Chinese hamster
9_pfamImport   45 ISLFSTLLNNKHFLIIFVHALEQQK-DFAVRDRCNLASLLTIAL--HGKLEYYTSIMKDLLVDLIDASA-SKn-PKLMLR 119 
XP_014345025 1314 ITLFSTLLNNKHFLITFVHALEQQK-DFAVRDRCNLASLLTIAL--HGKLEYYTSIMKDLLVDLIDASA-SKn-PKLMLR 1388 coelacanth
XP_018671834 1330 LKSLLSVIKNKDVLLVLVRTLEEQR-KFTVQEKGNMASLLTICL--FDDLPYYTRVMLELLTGLIQKHV-SRn-PKLLLR 1404 vase tunicate
XP_030856366 1329 MSEFSKLLNRKEFLMQYIQGLDEAK-NLKQKDRVNIASLLSTILttEGRFHYLTDVMLTLMAEKIEESD-ENr-LKQLFK 1405 purple sea ur...
XP_030838904  351 MIMFSRQLGNPDFLTNFIKQLEEQR-KPKRRDRVNIASLITALLvtEGKFGYFTETLFKLLEESIEEGA-ESgrARSLFR 428  purple sea ur...
4M8N_A        164 RTESIVEKLLTNWMSICLYGFL-RESVGQPLFLLVSALTQQISKGPVDSVTEKALYTLSEDWLLCQAQDFEPLKLKVVFA 242  zebrafish
EGD75945     1556 RTESVAEKLLTAWLTTGMHDAV-LRDAARPLYNLTQALKIYAWKGPVDAVTGAATYTLNADALLRERVEYEPLTLHVDM- 1633 Salpingoeca r...
EKC27333      299 RFESISLRLLSHWLSVSLYPYL-KEGGGSSLFMLYKSTQTVVEKRPVDEVTGEAKNTLSEDNFLREKIDCLTMKLEIDLN 377  Pacific oyster
O45657       1304 NSDSVVEKMFSKWMSICLYSHL--TPQMNSYFYLYKALQYQTDKGPVDAVTGDARYTINEAKLLRESVDTKTLKIRVIPF 1381 Caenorhabditi...
EGW12632      172 RTESVVEKMLTNWMSICMYGCL-RETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQ 250  Chinese hamster
9_pfamImport  120 RTESVVEKMLTNWMSICMYSYL-RETVGEPFFLLICAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRTVSSWRD 198 
XP_014345025 1389 RTESVVEKMLSNWMAVCMYSYL-KETVGEPFFLLLCAIKQQINKGSIDALTGKARYTLNEEWLLRENIEARPLNLNVSFQ 1467 coelacanth
XP_018671834 1405 RSESVVEKMVSHWLSINLYDECiNEQAGKPLFLLTKAVHYLVSSAPCDVIAKKAFNSLNEMTLLGTELQYETVVLHATIV 1484 vase tunicate
XP_030856366 1406 SVGSILEKLISNWVALCMYKHL-QKQVAYPLYVLYQAIKGQVDKGPVDAITGQAHFSLNFDYLLDEDVEFEDVTLQIVD- 1483 purple sea ur...
XP_030838904  429 RTETIVEKLLSNWISLCMYQYL-KRQVAESLYLLYQSIKIQVEKGPIDITTGQSVFSLNFECLLEEEVEFNELTLSVVGR 507  purple sea ur...
4M8N_A        243 Vgtg----eeISESL--EVIALTCDTIQQVKEKILQTFQRKFGFRYTQQIRDIEI-----EY-EKE-GKfVMLQEVDDTS 309  zebrafish
EGD75945     1634 ----------NRQVY--EVHVNSCDTIGQILEKL-----KLVVTTAGADVSDFDTrvlvlQR-EEGl---RVLKDIDDSS 1692 Salpingoeca r...
EKC27333      378 G---------NGNLY--TCEVLDCDTINQVKSKCLYQIYKNKPASEMPSTDEVDL-----EW-MAGkSGrLTLSNIDQTS 440  Pacific oyster
O45657       1382 Ek--------CDESI--DLEVHACDAICQVKQKVASAVYRETPYSQRPRITQFEL-----KY-KCPkRGdVKLTDVLPIE 1445 Caenorhabditi...
EGW12632      251 Gc--------GMDSL--SVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDL-----EW-FASsTQsYVLRDLDDTS 314  Chinese hamster
9_pfamImport  199 SwagaapgphSSPRCpgHIP-LSAGSAPQEPPLPLGCSQKQVPASRLPA----QLcpphtEW-FATsTDsYILRDLDDTS 272 
XP_014345025 1468 Gl--------GMDSL--TIRVMDTDSISQVKEKILDVFYKNVPYSQWPREEDVDL-----EW-FPSnNKsCILRDLDDTS 1531 coelacanth
XP_018671834 1485 Eeg-----gkVTTSV--DVKVVNVDSIKQAKTKIIEAVYKDKPYSECPKPDDLDF-----ALmNSSeSTgITLSDVDGMS 1552 vase tunicate
XP_030856366 1484 ----------KEHKVleQVKVLDVDTITQAKQKILDAVYCKRQTAQQLRSNEVDL-----VL-LNGcMGrLVLKDRDPIT 1547 purple sea ur...
XP_030838904  508 D---------KHHKY--YVKVLDVDCMTQVKQKILDAAYRNSHIVQQNRAHEMDL-----LWyHPGgEe-RILKDRDELN 570  purple sea ur...
4M8N_A        310 EIRGH--VTMLNTLKHYQVGDGACI----KVITPkihaplktqns----------------------------------- 348  zebrafish
EGD75945     1693 KMSAG--WVQLNTASFYGMRDGDQL----AFVKSdtdggdarrrrnnnssssgggggg---------------------- 1744 Salpingoeca r...
EKC27333      441 ERGDG--MVRRNTLKHYHVLDNSRM----ALLYKfspdvehddeddtyvnqrspsdvd---------------------- 492  Pacific oyster
O45657       1446 TLSQKklPVKLFTLADYGISDGCTLemspAVYTAesyrnsladsgqssw------------------------------- 1494 Caenorhabditi...
EGW12632      315 VVEDG--RKKLNTLAHYKIPEGASL----AMSLTdkkdntlgr------------------------------------- 351  Chinese hamster
9_pfamImport  273 VVEDG--RKKLNTLAHYKIPEGASL----AMSLSvwllsvlrrstlqrlpi----------------------------- 317 
XP_014345025 1532 LMEDN--RKKLNTAAHYKIPDGAYL----AMSLKdkkdsslgr------------------------------------- 1568 coelacanth
XP_018671834 1553 VVDGK--YTKINTLKHYNVPDNAVV----VLRPHdvenqapqdv------------------------------------ 1590 vase tunicate
XP_030856366 1548 ETRGH--WIKANTIKAYKISNGSSV----AIVKKqdgtnpefsaplvldkaelaytyvprflesyspwstdknhtqyvkl 1621 purple sea ur...
XP_030838904  571 KTIGNtkGLFINTIKTYGVSDGCQV----ALIVKasmnetgtyqpvtpgvqlfqqyqe---------------------- 624  purple sea ur...
4M8N_A        349 -------------------vkddknfsikYFHLVDp---DID-TDLsnhp-------------------ekkaLKIKEMY 386  zebrafish
EGD75945     1745 ------ggggslfkvrtksksridpmacePWHLVK----PDT-DGTaaaaa------------------aaatRVPSEIF 1795 Salpingoeca r...
EKC27333      493 ------itippnvqliqsvsstgslenlrQWHLVK----NIE-EEDshekp------------------sklkDIGKTSH 543  Pacific oyster
O45657       1495 ---------------ssldrcspiyssskYYHLTN----PSSgTMTfkkkssn--------------dsnllpKSIPEVY 1541 Caenorhabditi...
EGW12632      352 ---------------------vkdldtekYFHLVL----PTD-ELVepkksh---------------rqshrkKVLPEIY 390  Chinese hamster
9_pfamImport  318 -------------nsnsrsvvtgarkalaLWDIIKnyqePQL-QPHrstsqrp-------------erqshrkKVLPEIY 370 
XP_014345025 1569 ---------------------vkdldtekYFHLVI----PND-DLAetkrsh---------------rqshrkKVLPEIY 1607 coelacanth
XP_018671834 1591 --------------------sspllppkhMYHLIN--------PSEeeqsngytdvqsdagkkademldnlmkRPFQEMF 1642 vase tunicate
XP_030856366 1622 naleapavnnvrtsweytqidvdpeegkqMWHLVK--------DESntvnsnskkk--------rphkidhrpKLIKEVY 1685 purple sea ur...
XP_030838904  625 -----hagpddvrdrdyirirtmesggsrIMHLVAenqiPTE-SSTsl------------------------tKLDREFL 674  purple sea ur...
4M8N_A        387 LIKLLSTKVAVHSFVENLFKSIWGLp--NNKAPLAVKYFFDFLDEQAERKKITDP-DVLHIWKTNSLPLRFWVNILKNPD 463  zebrafish
EGD75945     1796 LTYLMTVKTALQPFVDDLVDAVFNI----DQPSPAVRFLFHFLDDQARKHNISDP-RTTHIWKSNAFPLRFWINLIKNPD 1870 Salpingoeca r...
EKC27333      544 ITNLMHTKLVLQDNIKEVFDSVLN----HETVPLVVHYLFGVLENLANKNSV-EP-DTLLCWKSESYAMRVWATLLVRPE 617  Pacific oyster
O45657       1542 LTRLLTSKGTVETYVEDFLESVLYMh--DSSYPPILKFFFDILDREASVNGVSE--NICQQWKANGYVLRVWANFVRNPQ 1617 Caenorhabditi...
EGW12632      391 LTRLLSTKGTLQKFLDDLFKAILSIr--EDKPPLAVKYFFDFLEEQAEKRGISDP-DTLHIWKTNSLPLRFWVNILKNPQ 467  Chinese hamster
9_pfamImport  371 LTRLLSTKGTLQKFLDDLFKAILSIr--DDKPPVAVKYFFDFLEEQAEKRGITDP-DTMHIWKTNSLPLRFWVNILKNPQ 447 
XP_014345025 1608 LTRLLSTKGTLQKFLDDLFKAILCIt--GDKPPLAIKYFFDFLEEQAEKRGITDP-DTLHIWKTNSLPLRFWvnilknPQ 1684 coelacanth
XP_018671834 1643 LTRMVKAKTTIQEYVDGVFNSILR----PKPISKTVRYFFQFLDREADRHKINDP-EVLHIWKTNSLLLRYWVNVLKNPE 1717 vase tunicate
XP_030856366 1686 TSRLLVTKNAVQPFLDEFLEATFSLpegQSSLPVHIKHLFDFFDTHAEEHSEIKD-NVSAAWKTNSLALRYWVTAISHPS 1764 purple sea ur...
XP_030838904  675 APRLLVTKKTIQTRLDEFLACVFKK---PAETPLTIKYLFDFFDKMANKYCDEKPeEIAEAWKSNSLPLHYWMTTLTHPS 751  purple sea ur...
4M8N_A        464 FVFsDMEKSPHLDGCLSVIAQAFMDSFSLTDTHLDKHSPTNKLLYGKDIPQYKQEVKSYYKLVKDQTSISSQELKTFLQE 543  zebrafish
EGD75945     1871 FLL-HVQQTRTVSSGLSTVAQVIMDSCSVSDQQLGKHSPANKHLYRKEVAEYKQKIANFYTAISRLPPPTDAELQASFAS 1949 Salpingoeca r...
EKC27333      618 FLF-DIQKARHVEPCLNVIKQVFIDCFHST--KISKDSSLQKLLFAQEVPHYQKKTEQFYKALGNKAAITDADFWSEMSR 694  Pacific oyster
O45657       1618 LVF-DVPHSISMDANLSTVAQTMMDCFSFSEPVLGAHSPSSRLLFAKDVARLRPLSVDLFKRVKNSPPLGMDELRTELVN 1696 Caenorhabditi...
EGW12632      468 FVF-DIEKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAE 546  Chinese hamster
9_pfamImport  448 FVF-DIDKTDHIDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQEMNAHLAE 526 
XP_014345025 1685 FVF-DIEKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPKYKKSVQRYYRHIQDMTALSEQEMNAHLAE 1763 coelacanth
XP_018671834 1718 FVF-DLNKTDIVDSCLNVITQAFMDACTTTNRKLGHDSPSNKLLYAKDADNYKVMVKEFFINISNTPTVTQEEVTQILQK 1796 vase tunicate
XP_030856366 1765 FIF-DMQQSRTADYCINVLTNMLDHACKKNIPTYNLDASLNRILYRPELPRYIEMVEGYYNAIADLPGVSQSQLEEASQQ 1843 purple sea ur...
XP_030838904  752 YVF-DMRQSRSADQSVSVLANMLDNACKKIRSENTQESALNRVLFYRDLPGHIRTIGEYYENIKGLPPPTTEELQEDFNR 830  purple sea ur...
4M8N_A        544 ESKKHQNE--FNESAALRELYKYMQRYFTEI 572  zebrafish
EGD75945     1950 AQSGEQAC---DRPDAVCGLMEYALRFREQL 1977 Salpingoeca rosetta
EKC27333      695 LSLLQQEHlkFSKSAALVKLYRFVNQYVEEI 725  Pacific oyster
O45657       1697 MANDVSTC--KGSSLALSELLSWVRGNGIRI 1725 Caenorhabditis elegans
EGW12632      547 ESRKYQNE--FNTNVAMAEIYKYAKRYRPQI 575  Chinese hamster
9_pfamImport  527 ESRKYRNE--FNTNVAMAEIYKYAKRYRSQI 555 
XP_014345025 1764 ESRKYRNE--FNTSFAMTEIYKYAKRYRSQI 1792 coelacanth
XP_018671834 1797 QSASYASR--FNQMVALNGIYEHLVKYREQV 1825 vase tunicate
XP_030856366 1844 ITKEFSAH--FSRLGMLHQLYEYTKEHTDml 1872 purple sea urchin
XP_030838904  831 ITQDFSGL--FSRVATLSKLYDFTShdtgpl 859  purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap